LOADING...
   NM_024865;RC4044A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NM_024865    RC4044A.NANOG            JCSG 423217 PDB Deposition 14-SEP-12              PDB id: 4rbo

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNM_024865
DESCRIPTIONCASP Target
Description Hidden
ORGANISMHomo sapiens
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00046; Homeobox;
DR PDB; 2KT0; Identical; 02-FEB-10; HOMEOBOX PROTEIN NANOG;
DR PDB; 4RBO; Identical; 01-OCT-14; PUTATIVE HOMEOBOX PROTEIN NANOGP8;
DR PDB; 2VI6; Identical; 15-JAN-08; HOMEOBOX PROTEIN NANOG;
DR FFAS; 423216; Fold and function assignment.
DR TVPC; NM_024865; Homologs in PDB, JCSG and SG center.
DR OVP; NM_024865; Ortholog view popup.
DR TPM; NM_024865; Target PDB monitor.
DR FSS; NM_024865; Target function coverage.
PROPERTY Residues: 305 aa
Molecule Weight: 34617.89 Dalton
Isoelectric Point: 6.32
Extinction Coefficient: 73910
Gravy Index: -.84
Number of Met residues: 12
Percentage of Met residues: 3.93 %
Number of Cys residues: 9
Percentage of Cys residues: 2.95 %
SEQUENCE  amino acids 305 aa
>NM_024865  NM_024865 Homo sapiens Nanog homeobox (NANOG), mRNA, coding region:217-1131
MSVDPACPQSLPCFEASDCKESSPMPVICGPEENYPSLQMSSAEMPHTETVSPLPSSMDL
LIQDSPDSSTSPKGKQPTSAEKSVAKKEDKVPVKKQKTRTVFSSTQLCVLNDRFQRQKYL
SLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSS
YHQGCLVNPTGNLPMWSNQTWNNSTWSNQTQNIQSWSNHSWNTQTWCTQSWNNQAWNSPF
YNCGEESLQSCMQFQPNSPASDLEAALEAAGEGLNVIQQTTRYFSTPQTMDLFLNYSMNM
QPEDV

CDS  cDNA 915 bp
   1 atgagtgtgg atccagcttg tccccaaagc ttgccttgct ttgaagcatc cgactgtaaa    60
  61 gaatcttcac ctatgcctgt gatttgtggg cctgaagaaa actatccatc cttgcaaatg   120
 121 tcttctgctg agatgcctca cacggagact gtctctcctc ttccttcctc catggatctg   180
 181 cttattcagg acagccctga ttcttccacc agtcccaaag gcaaacaacc cacttctgca   240
 241 gagaagagtg tcgcaaaaaa ggaagacaag gtcccggtca agaaacagaa gaccagaact   300
 301 gtgttctctt ccacccagct gtgtgtactc aatgatagat ttcagagaca gaaatacctc   360
 361 agcctccagc agatgcaaga actctccaac atcctgaacc tcagctacaa acaggtgaag   420
 421 acctggttcc agaaccagag aatgaaatct aagaggtggc agaaaaacaa ctggccgaag   480
 481 aatagcaatg gtgtgacgca gaaggcctca gcacctacct accccagcct ttactcttcc   540
 541 taccaccagg gatgcctggt gaacccgact gggaaccttc caatgtggag caaccagacc   600
 601 tggaacaatt caacctggag caaccagacc cagaacatcc agtcctggag caaccactcc   660
 661 tggaacactc agacctggtg cacccaatcc tggaacaatc aggcctggaa cagtcccttc   720
 721 tataactgtg gagaggaatc tctgcagtcc tgcatgcagt tccagccaaa ttctcctgcc   780
 781 agtgacttgg aggctgcctt ggaagctgct ggggaaggcc ttaatgtaat acagcagacc   840
 841 actaggtatt ttagtactcc acaaaccatg gatttattcc taaactactc catgaacatg   900
 901 caacctgaag acgtg   915
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu