LOADING...
   NM_024312;NM_024312
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NM_024312                JCSG 430746 PDB Deposition 16-AUG-26

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNM_024312
DESCRIPTIONN-acetylglucosamine-1-phosphotransferase subunits alpha/beta (GNPTAB)
ORGANISMHomo sapiens
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF06464; DMAP_binding;
DR Pfam; PF00066; Notch;
DR FFAS; 424816; Fold and function assignment.
DR TVPC; NM_024312; Homologs in PDB, JCSG and SG center.
DR OVP; NM_024312; Ortholog view popup.
DR TPM; NM_024312; Target PDB monitor.
DR FSS; NM_024312; Target function coverage.
PROPERTY Residues: 1256 aa
Molecule Weight: 143614.49 Dalton
Isoelectric Point: 6.74
Extinction Coefficient: 144620
Gravy Index: -.45
Number of Met residues: 27
Percentage of Met residues: 2.15 %
Number of Cys residues: 22
Percentage of Cys residues: 1.75 %
SEQUENCE  amino acids 1256 aa
>NM_024312  NM_024312 AB1079_H09 Homo sapiens N-acetylglucosamine-1-phosphate transferase, alpha and beta subuni
MLFKLLQRQTYTCLSHRYGLYVCFLGVVVTIVSAFQFGEVVLEWSRDQYHVLFDSYRDNI
AGKSFQNRLCLPMPIDVVYTWVNGTDLELLKELQQVREQMEEEQKAMREILGKNTTEPTK
KSEKQLECLLTHCIKVPMLVLDPALPANITLKDLPSLYPSFHSASDIFNVAKPKNPSTNV
SVVVFDSTKDVEDAHSGLLKGNSRQTVWRGYLTTDKEVPGLVLMQDLAFLSGFPPTFKET
NQLKTKLPENLSSKVKLLQLYSEASVALLKLNNPKDFQELNKQTKKNMTIDGKELTISPA
YLLWDLSAISQSKQDEDISASRFEDNEELRYSLRSIERHAPWVRNIFIVTNGQIPSWLNL
DNPRVTIVTHQDVFRNLSHLPTFSSPAIESHIHRIEGLSQKFIYLNDDVMFGKDVWPDDF
YSHSKGQKVYLTWPVPNCAEGCPGSWIKDGYCDKACNNSACDWDGGDCSGNSGGSRYIAG
GGGTGSIGVGQPWQFGGGINSVSYCNQGCANSWLADKFCDQACNVLSCGFDAGDCGQDHF
HELYKVILLPNQTHYIIPKGECLPYFSFAEVAKRGVEGAYSDNPIIRHASIANKWKTIHL
IMHSGMNATTIHFNLTFQNTNDEEFKMQITVEVDTREGPKLNSTAQKGYENLVSPITLLP
EAEILFEDIPKEKRFPKFKRHDVNSTRRAQEEVKIPLVNISLLPKDAQLSLNTLDLQLEH
GDITLKGYNLSKSALLRSFLMNSQHAKIKNQAIITDETNDSLVAPQEKQVHKSILPNSLG
VSERLQRLTFPAVSVKVNGHDQGQNPPLDLETTARFRVETHTQKTIGGNVTKEKPPSLIV
PLESQMTKEKKITGKEKENSRMEENAENHIGVTEVLLGRKLQHYTDSYLGFLPWEKKKYF
QDLLDEEESLKTQLAYFTDSKNTGRQLKDTFADSLRYVNKILNSKFGFTSRKVPAHMPHM
IDRIVMQELQDMFPEEFDKTSFHKVRHSEDMQFAFSYFYYLMSAVQPLNISQVFDEVDTD
QSGVLSDREIRTLATRIHELPLSLQDLTGLEHMLINCSKMLPADITQLNNIPPTQESYYD
PNLPPVTKSLVTNCKPVTDKIHKAYKDKNKYRFEIMGEEEIAFKMIRTNVSHVVGQLDDI
RKNPRKFVCLNDNIDHNHKDAQTVKAVLRDFYESMFPIPSQFELPREYRNRFLHMHELQE
WRAYRDKLKFWTHCVLATLIMFTIFSFFAEQLIALKRKIFPRRRIHKEASPNRIRV

CDS  cDNA 3771 bp
   1 atgctgttca agctcctgca gagacagacc tatacctgcc tgtcccacag gtatgggctc    60
  61 tacgtgtgct tcttgggcgt cgttgtcacc atcgtctccg ccttccagtt cggagaggtg   120
 121 gttctggaat ggagccgaga tcaataccat gttttgtttg attcctatag agacaatatt   180
 181 gctggaaagt cctttcagaa tcggctttgt ctgcccatgc cgattgacgt tgtttacacc   240
 241 tgggtgaatg gcacagatct tgaactactg aaggaactac agcaggtcag agaacagatg   300
 301 gaggaggagc agaaagcaat gagagaaatc cttgggaaaa acacaacgga acctactaag   360
 361 aagagtgaga agcagttaga gtgtttgcta acacactgca ttaaggtgcc aatgcttgtc   420
 421 ctggacccag ccctgccagc caacatcacc ctgaaggacc tgccatctct ttatccttct   480
 481 tttcattctg ccagtgacat tttcaatgtt gcaaaaccaa aaaacccttc taccaatgtc   540
 541 tcagttgttg tttttgacag tactaaggat gttgaagatg cccactctgg actgcttaaa   600
 601 ggaaatagca gacagacagt atggaggggc tacttgacaa cagataaaga agtccctgga   660
 661 ttagtgctaa tgcaagattt ggctttcctg agtggatttc caccaacatt caaggaaaca   720
 721 aatcaactaa aaacaaaatt gccagaaaat ctttcctcta aagtcaaact gttgcagttg   780
 781 tattcagagg ccagtgtagc gcttctaaaa ctgaataacc ccaaggattt tcaagaattg   840
 841 aataagcaaa ctaagaagaa catgaccatt gatggaaaag aactgaccat aagtcctgca   900
 901 tatttattat gggatctgag cgccatcagc cagtctaagc aggatgaaga catctctgcc   960
 961 agtcgttttg aagataacga agaactgagg tactcattgc gatctatcga gaggcatgca  1020
1021 ccatgggttc ggaatatttt cattgtcacc aacgggcaga ttccatcctg gctgaacctt  1080
1081 gacaatcctc gagtgacaat agtaacacac caggatgttt ttcgaaattt gagccacttg  1140
1141 cctaccttta gttcacctgc tattgaaagt cacattcatc gcatcgaagg gctgtcccag  1200
1201 aagtttattt acctaaatga tgatgtcatg tttgggaagg atgtctggcc agatgatttt  1260
1261 tacagtcact ccaaaggcca gaaggtttat ttgacatggc ctgtgccaaa ctgtgccgag  1320
1321 ggctgcccag gttcctggat taaggatggc tattgtgaca aggcttgtaa taattcagcc  1380
1381 tgcgattggg atggtgggga ttgctctgga aacagtggag ggagtcgcta tattgcagga  1440
1441 ggtggaggta ctgggagtat tggagttgga cagccctggc agtttggtgg aggaataaac  1500
1501 agtgtctctt actgtaatca gggatgtgcg aattcctggc tcgctgataa gttctgtgac  1560
1561 caagcatgca atgtcttgtc ctgtgggttt gatgctggcg actgtgggca agatcatttt  1620
1621 catgaattgt ataaagtgat ccttctccca aaccagactc actatattat tccaaaaggt  1680
1681 gaatgcctgc cttatttcag ctttgcagaa gtagccaaaa gaggagttga aggtgcctat  1740
1741 agtgacaatc caataattcg acatgcttct attgccaaca agtggaaaac catccacctc  1800
1801 ataatgcaca gtggaatgaa tgccaccaca atacatttta atctcacgtt tcaaaataca  1860
1861 aacgatgaag agttcaaaat gcagataaca gtggaggtgg acacaaggga gggaccaaaa  1920
1921 ctgaattcta cagcccagaa gggttacgaa aatttagtta gtcccataac acttcttcca  1980
1981 gaggcggaaa tcctttttga ggatattccc aaagaaaaac gcttcccgaa gtttaagaga  2040
2041 catgatgtta actcaacaag gagagcccag gaagaggtga aaattcccct ggtaaatatt  2100
2101 tcactccttc caaaagacgc ccagttgagt ctcaatacct tggatttgca actggaacat  2160
2161 ggagacatca ctttgaaagg atacaatttg tccaagtcag ccttgctgag atcatttctg  2220
2221 atgaactcac agcatgctaa aataaaaaat caagctataa taacagatga aacaaatgac  2280
2281 agtttggtgg ctccacagga aaaacaggtt cataaaagca tcttgccaaa cagcttagga  2340
2341 gtgtctgaaa gattgcagag gttgactttt cctgcagtga gtgtaaaagt gaatggtcat  2400
2401 gaccagggtc agaatccacc cctggacttg gagaccacag caagatttag agtggaaact  2460
2461 cacacccaaa aaaccatagg cggaaatgtg acaaaagaaa agcccccatc tctgattgtt  2520
2521 ccactggaaa gccagatgac aaaagaaaag aaaatcacag ggaaagaaaa agagaacagt  2580
2581 agaatggagg aaaatgctga aaatcacata ggcgttactg aagtgttact tggaagaaag  2640
2641 ctgcagcatt acacagatag ttacttgggc tttttgccat gggagaaaaa aaagtatttc  2700
2701 caagatcttc tcgacgaaga agagtcattg aagacacaat tggcatactt cactgatagc  2760
2761 aaaaatactg ggaggcaact aaaagataca tttgcagatt ccctcagata tgtaaataaa  2820
2821 attctaaata gcaagtttgg attcacatcg cggaaagtcc ctgctcacat gcctcacatg  2880
2881 attgaccgga ttgttatgca agaactgcaa gatatgttcc ctgaagaatt tgacaagacg  2940
2941 tcatttcaca aagtgcgcca ttctgaggat atgcagtttg ccttctctta tttttattat  3000
3001 ctcatgagtg cagtgcagcc actgaatata tctcaagtct ttgatgaagt tgatacagat  3060
3061 caatctggtg tcttgtctga cagagaaatc cgaacactgg ctaccagaat tcacgaactg  3120
3121 ccgttaagtt tgcaggattt gacaggtctg gaacacatgc taataaattg ctcaaaaatg  3180
3181 cttcctgctg atatcacgca gctaaataat attccaccaa ctcaggaatc ctactatgat  3240
3241 cccaacctgc caccggtcac taaaagtcta gtaacaaact gtaaaccagt aactgacaaa  3300
3301 atccacaaag catataagga caaaaacaaa tataggtttg aaatcatggg agaagaagaa  3360
3361 atcgctttta aaatgattcg taccaacgtt tctcatgtgg ttggccagtt ggatgacata  3420
3421 agaaaaaacc ctaggaagtt tgtttgcctg aatgacaaca ttgaccacaa tcataaagat  3480
3481 gctcagacag tgaaggctgt tctcagggac ttctatgaat ccatgttccc cataccttcc  3540
3541 caatttgaac tgccaagaga gtatcgaaac cgtttccttc atatgcatga gctgcaggaa  3600
3601 tggagggctt atcgagacaa attgaagttt tggacccatt gtgtactagc aacattgatt  3660
3661 atgtttacta tattctcatt ttttgctgag cagttaattg cacttaagcg gaagatattt  3720
3721 cccagaagga ggatacacaa agaagctagt cccaatcgaa tcagagtata g  3771
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu