LOADING...
   NM_013261;NM_013261
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NM_013261    RF.A2635A            JCSG 429241 Proposed Target 11-DEC-02

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNM_013261
DESCRIPTIONNM_013261 Homo sapiens peroxisome proliferator-activated receptor gamma, coactiv
ator 1 alpha (PPARGC1A), mRNA, coding region:121-2517
ORGANISMHOMO SAPIENS
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00076; RRM_1;
DR PDB; 3D24; Identical; 10-JUN-08; STEROID HORMONE RECEPTOR ERR1;
DR FFAS; 429241; Fold and function assignment.
DR TVPC; NM_013261; Homologs in PDB, JCSG and SG center.
DR OVP; NM_013261; Ortholog view popup.
DR TPM; NM_013261; Target PDB monitor.
DR FSS; NM_013261; Target function coverage.
PROPERTY Residues: 798 aa
Molecule Weight: 91021.81 Dalton
Isoelectric Point: 5.71
Extinction Coefficient: 76210
Gravy Index: -1.1
Number of Met residues: 6
Percentage of Met residues: 0.75 %
Number of Cys residues: 20
Percentage of Cys residues: 2.51 %
SEQUENCE  amino acids 798 aa
>NM_013261  NM_013261 Homo sapiens peroxisome proliferator-activated receptor gamma, coactivator 1 alpha (PPARGC
MAWDMCNQDSESVWSDIECAALVGEDQPLCPDLPELDLSELDVNDLDTDSFLGGLKWCSD
QSEIISNQYNNEPSNIFEKIDEENEANLLAVLTETLDSLPVDEDGLPSFDALTDGDVTTD
NEASPSSMPDGTPPPQEAEEPSLLKKLLLAPANTQLSYNECSGLSTQNHANHNHRIRTNP
AIVKTENSWSNKAKSICQQQKPQRRPCSELLKYLTTNDDPPHTKPTENRNSSRDKCTSKK
KSHTQSQSQHLQAKPTTLSLPLTPESPNDPKGSPFENKTIERTLSVELSGTAGLTPPTTP
PHKANQDNPFRASPKLKSSCKTVVPPPSKKPRYSESSGTQGNNSTKKGPEQSELYAQLSK
SSVLTGGHEERKTKRPSLRLFGDHDYCQSINSKTEILINISQELQDSRQLENKDVSSDWQ
GQICSSTDSDQCYLRETLEASKQVSPCSTRKQLQDQEIRAELNKHFGHPSQAVFDDEADK
TGELRDSDFSNEQFSKLPMFINSGLAMDGLFDDSEDESDKLSYPWDGTQSYSLFNVSPSC
SSFNSPCRDSVSPPKSLFSQRPQRMRSRSRSFSRHRSCSRSPYSRSRSRSPGSRSSSRSC
YYYESSHYRHRTHRNSPLYVRSRSRSPYSRRPRYDSYEEYQHERLKREEYRREYEKRESE
RAKQRERQRQKAIEERRVIYVGKIRPDTTRTELRDRFEVFGEIEECTVNLRDDGDSYGFI
TYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKY
DSLDFDSLLKEAQRSLRR

CDS  cDNA 2397 bp
   1 atggcgtggg acatgtgcaa ccaggactct gagtctgtat ggagtgacat cgagtgtgct    60
  61 gctctggttg gtgaagacca gcctctttgc ccagatcttc ctgaacttga tctttctgaa   120
 121 ctagatgtga acgacttgga tacagacagc tttctgggtg gactcaagtg gtgcagtgac   180
 181 caatcagaaa taatatccaa tcagtacaac aatgagcctt caaacatatt tgagaagata   240
 241 gatgaagaga atgaggcaaa cttgctagca gtcctcacag agacactaga cagtctccct   300
 301 gtggatgaag acggattgcc ctcatttgat gcgctgacag atggagacgt gaccactgac   360
 361 aatgaggcta gtccttcctc catgcctgac ggcacccctc caccccagga ggcagaagag   420
 421 ccgtctctac ttaagaagct cttactggca ccagccaaca ctcagctaag ttataatgaa   480
 481 tgcagtggtc tcagtaccca gaaccatgca aatcacaatc acaggatcag aacaaaccct   540
 541 gcaattgtta agactgagaa ttcatggagc aataaagcga agagtatttg tcaacagcaa   600
 601 aagccacaaa gacgtccctg ctcggagctt ctcaaatatc tgaccacaaa cgatgaccct   660
 661 cctcacacca aacccacaga gaacagaaac agcagcagag acaaatgcac ctccaaaaag   720
 721 aagtcccaca cacagtcgca gtcacaacac ttacaagcca aaccaacaac tttatctctt   780
 781 cctctgaccc cagagtcacc aaatgacccc aagggttccc catttgagaa caagactatt   840
 841 gaacgcacct taagtgtgga actctctgga actgcaggcc taactccacc caccactcct   900
 901 cctcataaag ccaaccaaga taaccctttt agggcttctc caaagctgaa gtcctcttgc   960
 961 aagactgtgg tgccaccacc atcaaagaag cccaggtaca gtgagtcttc tggtacacaa  1020
1021 ggcaataact ccaccaagaa agggccggag caatccgagt tgtatgcaca actcagcaag  1080
1081 tcctcagtcc tcactggtgg acacgaggaa aggaagacca agcggcccag tctgcggctg  1140
1141 tttggtgacc atgactattg ccagtcaatt aattccaaaa cagaaatact cattaatata  1200
1201 tcacaggagc tccaagactc tagacaacta gaaaataaag atgtctcctc tgattggcag  1260
1261 gggcagattt gttcttccac agattcagac cagtgctacc tgagagagac tttggaggca  1320
1321 agcaagcagg tctctccttg cagcacaaga aaacagctcc aagaccagga aatccgagcc  1380
1381 gagctgaaca agcacttcgg tcatcccagt caagctgttt ttgacgacga agcagacaag  1440
1441 accggtgaac tgagggacag tgatttcagt aatgaacaat tctccaaact acctatgttt  1500
1501 ataaattcag gactagccat ggatggcctg tttgatgaca gcgaagatga aagtgataaa  1560
1561 ctgagctacc cttgggatgg cacgcaatcc tattcattgt tcaatgtgtc tccttcttgt  1620
1621 tcttctttta actctccatg tagagattct gtgtcaccac ccaaatcctt attttctcaa  1680
1681 agaccccaaa ggatgcgctc tcgttcaagg tccttttctc gacacaggtc gtgttcccga  1740
1741 tcaccatatt ccaggtcaag atcaaggtct ccaggcagta gatcctcttc aagatcctgc  1800
1801 tattactatg agtcaagcca ctacagacac cgcacgcacc gaaattctcc cttgtatgtg  1860
1861 agatcacgtt caagatcgcc ctacagccgt cggcccaggt atgacagcta cgaggaatat  1920
1921 cagcacgaga ggctgaagag ggaagaatat cgcagagagt atgagaagcg agagtctgag  1980
1981 agggccaagc aaagggagag gcagaggcag aaggcaattg aagagcgccg tgtgatttat  2040
2041 gtcggtaaaa tcagacctga cacaacacgg acagaactga gggaccgttt tgaagttttt  2100
2101 ggtgaaattg aggagtgcac agtaaatctg cgggatgatg gagacagcta tggtttcatt  2160
2161 acctaccgtt atacctgtga tgcttttgct gctcttgaaa atggatacac tttgcgcagg  2220
2221 tcaaacgaaa ctgactttga gctgtacttt tgtggacgca agcaattttt caagtctaac  2280
2281 tatgcagacc tagattcaaa ctcagatgac tttgaccctg cttccaccaa gagcaagtat  2340
2341 gactctctgg attttgatag tttactgaaa gaagctcaga gaagcttgcg caggtaa  2397
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu