LOADING...
   NM_004959;RC2003B.SF_1
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NM_004959    RC2003B.SF_1            JCSG 424699 PDB Deposition 14-JUN-05

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNM_004959
DESCRIPTIONNM_004959 Homo sapiens nuclear receptor subfamily 5, group A, member 1 (NR5A1),
mRNA, coding region:188-1573
ORGANISMHOMO SAPIENS
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00105; zf-C4;
DR Pfam; PF00104; Hormone_recep;
DR PDB; 4QJR; Identical; 30-JUL-14; STEROIDOGENIC FACTOR 1;
DR PDB; 4QK4; Identical; 30-JUL-14; STEROIDOGENIC FACTOR 1;
DR PDB; 1YOW; Identical; 10-MAY-05; STEROIDOGENIC FACTOR 1;
DR PDB; 1ZDT; Identical; 24-MAY-05; STEROIDOGENIC FACTOR 1;
DR PDB; 1YP0; Identical; 19-APR-05; NUCLEAR RECEPTOR SUBFAMILY 5, GROUP A, MEMBER 1;
DR PDB; 1YMT; Identical; 15-MAR-05; STEROIDOGENIC FACTOR 1;
DR PDB; 3F7D; Identical; 09-DEC-08; NUCLEAR RECEPTOR SF-1;
DR PDB; 3TX7; Highly similar; 14-DEC-11; CATENIN BETA-1;
DR FFAS; 424699; Fold and function assignment.
DR TVPC; NM_004959; Homologs in PDB, JCSG and SG center.
DR OVP; NM_004959; Ortholog view popup.
DR TPM; NM_004959; Target PDB monitor.
DR FSS; NM_004959; Target function coverage.
PROPERTY Residues: 461 aa
Molecule Weight: 51633.17 Dalton
Isoelectric Point: 7.81
Extinction Coefficient: 37820
Gravy Index: -.28
Number of Met residues: 12
Percentage of Met residues: 2.60 %
Number of Cys residues: 17
Percentage of Cys residues: 3.69 %
SEQUENCE  amino acids 461 aa
>NM_004959  NM_004959 Homo sapiens nuclear receptor subfamily 5, group A, member 1 (NR5A1), mRNA, coding region:
MDYSYDEDLDELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKHYTCTESQSCKIDKT
QRKRCPFCRFQKCLTVGMRLEAVRADRMRGGRNKFGPMYKRDRALKQQKKAQIRANGFKL
ETGPPMGVPPPPPPAPDYVLPPSLHGPEPKGLAAGPPAGPLGDFGAPALPMAVPGAHGPL
AGYLYPAFPGRAIKSEYPEPYASPPQPGLPYGYPEPFSGGPNVPELILQLLQLEPDEDQV
RARILGCLQEPTKSRPDQPAAFGLLCRMADQTFISIVDWARRCMVFKELEVADQMTLLQN
CWSELLVFDHIYRQVQHGKEGSILLVTGQEVELTTVATQAGSLLHSLVLRAQELVLQLLA
LQLDRQEFVCLKFIILFSLDLKFLNNHILVKDAQEKANAALLDYTLCHYPHCGDKFQQLL
LCLVEVRALSMQAKEYLYHKHLGNEMPRNNLLIEMLQAKQT

CDS  cDNA 1386 bp
   1 atggactatt cgtacgacga ggacctggac gagctgtgcc ccgtgtgcgg ggacaaggtg    60
  61 tccggctacc actacggact gctcacgtgt gagagctgca agggcttctt caagcgcacg   120
 121 gtgcagaaca acaagcacta cacgtgcacc gagagccaga gctgcaagat cgacaagacg   180
 181 cagcgcaagc gctgtccctt ctgccgcttc cagaaatgcc tgacggtggg gatgcgcctg   240
 241 gaagccgtgc gcgctgaccg tatgaggggt ggccggaaca agtttgggcc gatgtacaag   300
 301 cgggaccggg ccctgaaaca gcagaagaag gcacagattc gggccaatgg cttcaagctg   360
 361 gagacagggc ccccgatggg ggtgcccccg ccgccccctc ccgcaccgga ctacgtgctg   420
 421 cctcccagcc tgcatgggcc tgagcccaag ggcctggccg ccggtccacc tgctgggcca   480
 481 ctgggcgact ttggggcccc agcactgccc atggccgtgc ccggtgccca cgggccactg   540
 541 gctggctacc tctaccctgc ctttcctggc cgtgccatca agtctgagta cccggagcct   600
 601 tatgccagcc ccccacagcc tgggctgccg tacggctacc cagagccctt ctctggaggg   660
 661 cccaacgtgc ctgagctcat cctgcagctg ctgcagctgg agccggatga ggaccaggtg   720
 721 cgggcccgca tcttgggctg cctgcaggag cccaccaaaa gccgccccga ccagccggcg   780
 781 gccttcggcc tcctgtgcag aatggccgac cagaccttca tctccatcgt ggactgggca   840
 841 cgcaggtgca tggtcttcaa ggagctggag gtggccgacc agatgacgct gctgcagaac   900
 901 tgctggagcg agctgctggt gttcgaccac atctaccgcc aggtccagca cggcaaggag   960
 961 ggcagcatcc tgctggtcac cgggcaggag gtggagctga ccacagtggc cacccaggcg  1020
1021 ggctcgctgc tgcacagcct ggtgttgcgg gcgcaggagc tggtgctgca gctgcttgcg  1080
1081 ctgcagctgg accggcagga gtttgtctgc ctcaagttca tcatcctctt cagcctggat  1140
1141 ttgaagttcc tgaataacca catcctggtg aaagacgctc aggagaaggc caacgccgcc  1200
1201 ctgcttgact acaccctgtg ccactacccg cactgcgggg acaaattcca gcagctgctg  1260
1261 ctgtgcctgg tggaggtgcg ggccctgagc atgcaggcca aggagtacct gtaccacaag  1320
1321 cacctgggca acgagatgcc ccgcaacaac ctgctcatcg aaatgctgca agccaagcag  1380
1381 acttga  1386
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu