LOADING...
   NM_002139;WS.A20613E.RBMX
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NM_002139    WS.A20613E.RBMX            JCSG 430561 PDB Deposition 14-FEB-14              PDB id: 2mks

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNM_002139
DESCRIPTIONNMR structure of RRM domain of RBMX
ORGANISMHomo sapiens
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00076; RRM_1;
DR Pfam; PF08081; RBM1CTR;
DR PDB; 2MB0; Identical; 09-APR-14; RNA-BINDING MOTIF PROTEIN, X CHROMOSOME;
DR PDB; 2MKS; Identical; 12-MAR-14; RNA-BINDING MOTIF PROTEIN, X CHROMOSOME;
DR FFAS; 430558; Fold and function assignment.
DR TVPC; NM_002139; Homologs in PDB, JCSG and SG center.
DR OVP; NM_002139; Ortholog view popup.
DR TPM; NM_002139; Target PDB monitor.
DR FSS; NM_002139; Target function coverage.
PROPERTY Residues: 391 aa
Molecule Weight: 42329.46 Dalton
Isoelectric Point: 10.06
Extinction Coefficient: 40230
Gravy Index: -1.37
Number of Met residues: 8
Percentage of Met residues: 2.05 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 391 aa
>NM_002139  NM_002139 Homo sapiens RNA binding motif protein, X-linked (RBMX), transcript variant 1, mRNA, codin
MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEVLLMKDRETNKSRGFAFVTFESPA
DAKDAARDMNGKSLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGRGGSGGTR
GPPSRGGHMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPPPKRSAPSGPVRSSSGMGGR
APVSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSRDYPSSRDTRDYAPPPRD
YTYRDYGHSSSRDDYPSRGYSDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPPTRGP
PPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPP
RDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY

CDS  cDNA 1176 bp
   1 atggttgaag cagatcgccc aggaaagctc ttcattggtg ggcttaatac ggaaacaaat    60
  61 gagaaagctc ttgaagcagt atttggcaaa tatggacgaa tagtggaagt actcttgatg   120
 121 aaagaccgtg aaaccaacaa atcaagagga tttgcttttg tcacctttga aagcccagca   180
 181 gacgctaagg atgcagccag agacatgaat ggaaagtcat tagatggaaa agccatcaag   240
 241 gtggaacaag ccaccaaacc atcatttgaa agtggtagac gtggaccgcc tccacctcca   300
 301 agaagtagag gccctccaag aggtcttaga ggtggaagag gaggaagtgg aggaaccagg   360
 361 ggacctccct cacggggagg acacatggat gacggtggat attccatgaa ttttaacatg   420
 421 agttcttcca ggggaccact cccagtaaaa agaggaccac caccaagaag tgggggtcct   480
 481 cctcctaaga gatctgcacc ttcaggacca gttcgcagta gcagtggaat gggaggaaga   540
 541 gctcctgtat cacgtggaag agatagttat ggaggtccac ctcgaaggga accgctgccc   600
 601 tctcgtagag atgtttattt gtccccaaga gatgatgggt attctactaa agacagctat   660
 661 tcaagcagag attacccaag ttctcgtgat actagagatt atgcaccacc accacgagat   720
 721 tatacttacc gtgattatgg tcattccagt tcacgtgatg actatccatc aagaggatat   780
 781 agcgatagag atggatatgg tcgtgatcgt gactattcag atcatccaag tggaggttcc   840
 841 tacagagatt catatgagag ttatggtaac tcacgtagtg ctccacctac acgagggccc   900
 901 ccgccatctt atggtggaag cagtcgctat gatgattaca gcagctcacg tgacggatat   960
 961 ggtggaagtc gagacagtta ctcaagcagc cgaagtgatc tctactcaag tggtcgtgat  1020
1021 cgggttggca gacaagaaag agggcttccc ccttctatgg aaagggggta ccctcctcca  1080
1081 cgtgattcct acagcagttc aagccgcgga gcaccaagag gtggtggccg tggaggaagc  1140
1141 cgatctgata gagggggagg cagaagcaga tactag  1176
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu