LOADING...
   NM_002092;NM_002092
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NM_002092    WS.B3220B            JCSG 429305 PDB Deposition 14-JUL-10

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNM_002092
DESCRIPTIONCASP Target
Description Hidden
ORGANISMHomo sapiens
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00076; RRM_1;
DR PDB; 2LMI; Identical; 28-DEC-11; G-RICH SEQUENCE FACTOR 1;
DR PDB; 4QU6; Identical; 13-AUG-14; G-RICH SEQUENCE FACTOR 1;
DR PDB; 4QU7; Identical; 13-AUG-14; G-RICH SEQUENCE FACTOR 1;
DR FFAS; 430375; Fold and function assignment.
DR TVPC; NM_002092; Homologs in PDB, JCSG and SG center.
DR OVP; NM_002092; Ortholog view popup.
DR TPM; NM_002092; Target PDB monitor.
DR FSS; NM_002092; Target function coverage.
PROPERTY Residues: 480 aa
Molecule Weight: 53133.45 Dalton
Isoelectric Point: 5.83
Extinction Coefficient: 34840
Gravy Index: -.33
Number of Met residues: 13
Percentage of Met residues: 2.71 %
Number of Cys residues: 9
Percentage of Cys residues: 1.88 %
SEQUENCE  amino acids 480 aa
>NM_002092  NM_002092 Homo sapiens G-rich RNA sequence binding factor 1 (GRSF1), transcript variant 1, mRNA, cod
MAGTRWVLGALLRGCGCNCSSCRRTGAACLPFYSAAGSIPSGVSGRRRLLLLLGAAAAAA
SQTRGLQTGPVPPGRLAGPPAVATSAAAAAAASYPALRASLLPQSLAAAAAVPTRSYSQE
SKTTYLEDLPPPPEYELAPSKLEEEVDDVFLIRAQGLPWSCTMEDVLNFFSDCRIRNGEN
GIHFLLNRDGKRRGDALIEMESEQDVQKALEKHRMYMGQRYVEVYEINNEDVDALMKSLQ
VKSSPVVNDGVVRLRGLPYSCNEKDIVDFFAGLNIVDITFVMDYRGRRKTGEAYVQFEEP
EMANQALLKHREEIGNRYIEIFPSRRNEVRTHVGSYKGKKIASFPTAKYITEPEMVFEEH
EVNEDIQPMTAFESEKEIELPKEVPEKLPEAADFGTTSSLHFVHMRGLPFQANAQDIINF
FAPLKPVRITMEYSSSGKATGEADVHFETHEDAVAAMLKDRSHVHHRYIELFLNSCPKGK

CDS  cDNA 1443 bp
   1 atggccggca cgcgctgggt actcggggcg ctgctccggg gctgcggctg taactgcagc    60
  61 agctgccggc gcaccggcgc cgcctgcctg cccttctact ccgccgctgg ctctatcccg   120
 121 tcgggcgtct cgggccgccg ccgcctgctg ctgctgctcg gggccgccgc ggccgctgcc   180
 181 tcccagacgc gtggcctcca gaccgggcct gtgcctcccg ggaggctggc ggggcctccc   240
 241 gctgtggcca cctctgccgc ggccgcggcc gccgcgtcct accctgccct ccgtgcctct   300
 301 ctgctgccgc agtcgctggc ggcggcggcc gccgtcccga cgcgcagcta cagccaggag   360
 361 tccaaaacta cttacctgga agaccttcca ccaccccctg agtatgaatt ggccccgtcc   420
 421 aagttagaag aggaagtgga tgatgtcttt ctcattcgag ctcaaggact gccctggtca   480
 481 tgcactatgg aagatgtgct taactttttt tcagactgca gaatccgcaa cggtgagaat   540
 541 ggaatacatt ttctcctaaa cagagatggg aaacgaaggg gtgatgcctt aattgaaatg   600
 601 gagtcagagc aggatgtgca gaaagcctta gagaagcacc gcatgtacat gggccagcgg   660
 661 tatgtggaag tatatgagat aaacaatgaa gatgtggatg ccttaatgaa gagcttgcag   720
 721 gtcaaatctt cgcctgtggt aaatgatggt gtggttcgtt tgagaggact tccttatagt   780
 781 tgcaatgaga aagacattgt agacttcttt gcaggactga atatagttga cattactttt   840
 841 gtgatggact atagagggag gcgaaaaaca ggggaagcct atgtgcaatt tgaagaacca   900
 901 gaaatggcca accaagccct gttgaaacac agggaagaaa ttggtaatcg atacatcgag   960
 961 atatttccaa gcagaaggaa tgaagttcga acacatgtcg gttcttataa gggaaagaaa  1020
1021 atcgcatctt ttcctactgc taagtatata actgagccag aaatggtctt tgaagaacat  1080
1081 gaagtaaatg aggatattca acccatgaca gcttttgaaa gtgagaagga aatagaattg  1140
1141 cctaaggagg tgccagaaaa gcttccagag gctgctgatt ttggaactac gtcttctctg  1200
1201 cattttgtcc acatgagagg attacctttc caagccaatg cccaagacat tataaacttt  1260
1261 tttgctccac tcaagcctgt tagaatcacc atggaataca gctccagtgg gaaggccact  1320
1321 ggagaagctg atgtgcactt tgagacccat gaggatgctg ttgcagcgat gctcaaggat  1380
1381 cggtcccacg ttcatcatag gtatattgaa ctgttcctga attcatgtcc aaaaggaaaa  1440
1441 taa  1443
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu