LOADING...
   NM_001159677;NM_001159677
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NM_001159677    WS.B20613D.SYNCRIP            JCSG 430610 PDB Deposition 16-AUG-26

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNM_001159677
DESCRIPTIONacidic domain of SYNCRIP RNA-binding protein
ORGANISMHomo sapiens
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00076; RRM_1;
DR PDB; 2DGU; Identical; 15-SEP-06; HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN Q;
DR PDB; 2MXT; Identical; 21-JAN-15; HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN Q;
DR FFAS; 430383; Fold and function assignment.
DR TVPC; NM_001159677; Homologs in PDB, JCSG and SG center.
DR OVP; NM_001159677; Ortholog view popup.
DR TPM; NM_001159677; Target PDB monitor.
DR FSS; NM_001159677; Target function coverage.
PROPERTY Residues: 562 aa
Molecule Weight: 62653.14 Dalton
Isoelectric Point: 7.18
Extinction Coefficient: 64180
Gravy Index: -.76
Number of Met residues: 11
Percentage of Met residues: 1.96 %
Number of Cys residues: 4
Percentage of Cys residues: 0.71 %
SEQUENCE  amino acids 562 aa
>NM_001159677  NM_001159677 Homo sapiens synaptotagmin binding, cytoplasmic RNA interacting protein (SYNCRIP), tran
MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAGLVAHSDLDER
AIEALKEFNEDGALAVLQQFKDSDLSHVQNKSAFLCGVMKTYRQREKQGTKVADSSKGPD
EAKIKALLERTGYTLDVTTGQRKYGGPPPDSVYSGQQPSVGTEIFVGKIPRDLFEDELVP
LFEKAGPIWDLRLMMDPLTGLNRGYAFVTFCTKEAAQEAVKLYNNHEIRSGKHIGVCISV
ANNRLFVGSIPKSKTKEQILEEFSKVTEGLTDVILYHQPDDKKKNRGFCFLEYEDHKTAA
QARRRLMSGKVKVWGNVGTVEWADPIEDPDPEVMAKVKVLFVRNLANTVTEEILEKAFSQ
FGKLERVKKLKDYAFIHFDERDGAVKAMEEMNGKDLEGENIEIVFAKPPDQKRKERKAQR
QAAKNQMYDDYYYYGPPHMPPPTRGRGRGGRGGYGYPPDYYGYEDYYDYYGYDYHNYRGG
YEDPYYGYEDFQVGARGRGGRGARGAAPSRGRGAAPPRGRAGYSQRGGPGSARGVRGARG
GAQQQRGRGQGKGVEAGPDLLQ

CDS  cDNA 1689 bp
   1 atggctacag aacatgttaa tggaaatggt actgaagagc ccatggatac tacttctgca    60
  61 gttatccatt cagaaaattt tcagacattg cttgatgctg gtttaccaca gaaagttgct   120
 121 gaaaaactag atgaaattta cgttgcaggg ctagttgcac atagtgattt agatgaaaga   180
 181 gctattgaag ctttaaaaga attcaatgaa gacggtgcat tggcagttct tcaacagttt   240
 241 aaagacagtg atctctctca tgttcagaac aaaagtgcct ttttatgtgg agtcatgaag   300
 301 acttacaggc agagagaaaa acaagggacc aaagtagcag attctagtaa aggaccagat   360
 361 gaggcaaaaa ttaaggcact cttggaaaga acaggctaca cacttgatgt gaccactgga   420
 421 cagaggaagt atggaggacc acctccagat tccgtttatt caggtcagca gccttctgtt   480
 481 ggcactgaga tatttgtggg aaagatccca agagatctat ttgaggatga acttgttcca   540
 541 ttatttgaga aagctggacc tatatgggat cttcgtctaa tgatggatcc actcactggt   600
 601 ctcaatagag gttatgcgtt tgtcactttt tgtacaaaag aagcagctca ggaggctgtt   660
 661 aaactgtata ataatcatga aattcgttct ggaaaacata ttggtgtctg catctcagtt   720
 721 gccaacaata ggctttttgt gggctctatt cctaagagta aaaccaagga acagattctt   780
 781 gaagaattta gcaaagtaac agagggtctt acagacgtca ttttatacca ccaaccggat   840
 841 gacaagaaaa aaaacagagg cttttgcttt cttgaatatg aagatcacaa aacagctgcc   900
 901 caggcaaggc gtaggttaat gagtggtaaa gtcaaggtct gggggaatgt tggaactgtt   960
 961 gaatgggctg atcctataga agatcctgat cctgaggtta tggcaaaggt aaaagtgctg  1020
1021 tttgtacgca accttgccaa tactgtaaca gaagagattt tagaaaaggc atttagtcag  1080
1081 tttgggaaac tggaacgagt gaagaagtta aaagattatg cgttcattca ttttgatgag  1140
1141 cgagatggtg ctgtcaaggc tatggaagaa atgaatggca aagacttgga gggagaaaat  1200
1201 attgaaattg tttttgccaa gccaccagat cagaaaagga aagaaagaaa agctcagagg  1260
1261 caagcagcaa aaaatcaaat gtatgacgat tactactatt atggtccacc tcatatgccc  1320
1321 cctccaacaa gaggtcgagg gcgtggaggt agaggtggtt atggatatcc tccagattat  1380
1381 tatggatatg aagattatta tgattattat ggttatgatt accataacta tcgtggtgga  1440
1441 tatgaagatc catactatgg ttatgaagat tttcaagttg gagctagagg aaggggtggt  1500
1501 agaggagcaa ggggtgctgc tccatccaga ggtcgtgggg ctgctcctcc ccgcggtaga  1560
1561 gccggttatt cacagagagg aggtcctgga tcagcaagag gcgttcgagg tgcgagagga  1620
1621 ggtgcccaac aacaaagagg ccgcgggcag ggaaaagggg tcgaggccgg tcctgacctg  1680
1681 ttacaatga  1689
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu