LOADING...
   NM_001098834;RF.A4044E
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
NM_001098834    RF.A4044E.GBX1            JCSG 424577 PDB Deposition 16-AUG-26              PDB id: 2me0, 2m34, 2me6

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONNM_001098834
DESCRIPTIONGastrulation brain homeobox 1 protein (GBX1)
ORGANISMHomo sapiens
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00046; Homeobox;
DR PDB; 2M34; Identical; 23-JAN-13; HOMEOBOX PROTEIN GBX-1;
DR PDB; 2ME0; Identical; 02-OCT-13; HOMEOBOX PROTEIN GBX-1;
DR PDB; 2ME6; Identical; 30-OCT-13; HOMEOBOX PROTEIN GBX-1;
DR FFAS; 424577; Fold and function assignment.
DR TVPC; NM_001098834; Homologs in PDB, JCSG and SG center.
DR OVP; NM_001098834; Ortholog view popup.
DR TPM; NM_001098834; Target PDB monitor.
DR FSS; NM_001098834; Target function coverage.
PROPERTY Residues: 363 aa
Molecule Weight: 37627.27 Dalton
Isoelectric Point: 7.04
Extinction Coefficient: 19940
Gravy Index: -.43
Number of Met residues: 5
Percentage of Met residues: 1.38 %
Number of Cys residues: 2
Percentage of Cys residues: 0.55 %
SEQUENCE  amino acids 363 aa
>NM_001098834  NM_001098834 Homo sapiens gastrulation brain homeobox 1 (GBX1), mRNA, coding region:233-1324
MQRAGGGSAPGGNGGGGGGGPGTAFSIDSLIGPPPPRSGHLLYTGYPMFMPYRPLVLPQA
LAPAPLPAGLPPLAPLASFAGRLTNTFCAGLGQAVPSMVALTTALPSFAEPPDAFYGPQE
LAAAAAAAAATAARNNPEPGGRRPEGGLEADELLPAREKVAEPPPPPPPHFSETFPSLPA
EGKVYSSDEEKLEASAGDPAGSEQEEEGSGGDSEDDGFLDSSAGGPGALLGPKPKLKGSL
GTGAEEGAPVTAGVTAPGGKSRRRRTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKL
SEVQVKIWFQNRRAKWKRIKAGNVSSRSGEPVRNPKIVVPIPVHVNRFAVRSQHQQMEQG
ARP

CDS  cDNA 1092 bp
   1 atgcagcggg ccggaggcgg tagcgcccct gggggcaacg gcgggggcgg cggcgggggc    60
  61 ccgggcactg ccttctccat cgactcccta atcgggccgc cgccgccgcg ctccggccac   120
 121 ttgctgtaca ccggctaccc catgttcatg ccctaccggc cgctcgtgct gccgcaggcg   180
 181 ctggcccctg cgccgctgcc cgctggcctc ccgcccctcg ccccgctagc ctctttcgcc   240
 241 ggccgcctta ccaacacctt ctgcgcgggg ctgggtcagg ctgtgccctc gatggtggcg   300
 301 ctgaccaccg cgctgcccag cttcgcggag ccgcccgacg ctttctacgg gccccaggag   360
 361 ctcgccgccg ccgctgccgc cgccgccgcc actgccgccc gaaacaaccc cgagccaggc   420
 421 ggccgacgcc cagagggtgg gctggaagct gatgagctgc tgccggcccg ggagaaagtg   480
 481 gcagagcccc caccacctcc gcctccgcac ttctcagaga cttttccaag tctgcccgca   540
 541 gaggggaagg tgtacagctc agatgaggag aagctggagg catcagcagg agacccagca   600
 601 ggcagcgaac aggaggaaga gggctcaggc ggtgacagcg aggatgacgg tttcctggac   660
 661 agttctgcag ggggcccagg ggctcttctg ggacctaaac cgaagctaaa gggaagcctg   720
 721 gggactggag ctgaggaggg ggcaccggtg acagcagggg tcacagctcc tggggggaaa   780
 781 agccgacggc gccgcacagc atttaccagc gagcagcttt tggaattgga gaaggaattt   840
 841 cattgcaaga aatacctgag cttgacagag cgctctcaga tcgcccacgc cctcaagctc   900
 901 agtgaggtgc aggtcaagat ctggtttcag aatcgacggg ccaagtggaa gcgcatcaaa   960
 961 gctggcaatg tgagcagccg ttctggggag cccgtaagaa accccaagat tgttgtcccc  1020
1021 atacctgtgc atgtcaacag gtttgctgtg cggagccagc accaacaaat ggagcagggg  1080
1081 gcccggccct ga  1092
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu