LOADING...
   YP_263484.1;MG3368B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
YP_263484.1    MG3368B            JCSG 391141 PDB Deposition 09-OCT-23              PDB id: 3ke3

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONYP_263484.1
DESCRIPTIONSerine-pyruvate aminotransferase [PLP-dependent transferase-like]
ORGANISMPsychrobacter arcticum 273-4
COMMENT 
DR UNIPROT; Q4FVA8_PSYAR
DR SPTR; Q4FVA8 (flat text); Q4FVA8 (good view)
DR GenBank; YP_263484
DR PDB; 3KE3; Identical; 03-NOV-09; PUTATIVE SERINE-PYRUVATE AMINOTRANSFERASE;
DR KEGG; 2.6.1.51; Enzyme page
DR FFAS; 391141; Fold and function assignment.
DR TVPC; YP_263484.1; Homologs in PDB, JCSG and SG center.
DR OVP; MG3368B; Ortholog view popup.
DR TPM; YP_263484.1; Target PDB monitor.
DR FSS; YP_263484.1; Target function coverage.
PROPERTY Residues: 378 aa
Molecule Weight: 41418.96 Dalton
Isoelectric Point: 4.89
Extinction Coefficient: 47900
Gravy Index: -.06
Number of Met residues: 9
Percentage of Met residues: 2.38 %
Number of Cys residues: 5
Percentage of Cys residues: 1.32 %
SEQUENCE  amino acids 378 aa
>YP_263484.1  gi|71064757|ref|YP_263484.1| possible serine-pyruvate aminotransferase [Psychrobacter arcticus 273-4
MTALRQDIDPNGLLEYSVVYTDRALNHMSKAFQEVMNDLLSNLKTVYNAEAAVIIPGSGT
YGMEAVARQLTIDEDCLIIRNGWFSYRWTQILEKGKFAKSSTVLTAERTEDTEAPKPFAP
VDIETAVAKIKEDKSAIVYAPHVETSSGIILSEEYIKALSEAVHSVGGLLVIDCIASGCV
WLDMKELGIDVLISAPQKGWSSTPCAGLVMLSAAAIKKVESTESNCFSLDLKQWLTIMRA
YENGGHAYHATMPTDSLRQFRDAILEAKEIGFDILRDAQWELGNRVRKVLTDKGIESVAA
EGFEAPGVVVSYTERDDMHKGSAFAEAGLQIAAGVPLKVGEPDNFKTFRLGLFGLDKLTD
IDGTVERFEKALDEVLAK

CDS  cDNA 1137 bp
   1 atgactgcat tacgtcaaga tattgatcca aacggcttat tagaatattc agtagtttat    60
  61 accgaccgcg ccctcaatca tatgtcaaaa gcctttcaag aggtgatgaa tgatttgctg   120
 121 agcaatttaa agaccgttta taacgctgaa gcagcggtta ttattccagg ttctggcacg   180
 181 tatggtatgg aagcagtcgc ccgtcaactg accattgatg aagattgcct catcatccgt   240
 241 aacggttggt ttagctatcg ttggacgcaa atcttagaaa aaggcaaatt tgccaagtca   300
 301 tctacggtac taacggctga gcgtacggaa gacactgaag cgccaaaacc atttgcgcca   360
 361 gtggatatcg aaacggcggt tgccaaaatt aaagaagata aatctgccat tgtttatgcg   420
 421 ccgcacgttg aaacgtcatc tggtattatc ttatcagaag aatacatcaa agcattgagt   480
 481 gaagcagtac atagcgttgg cggtttattg gtcattgact gtattgcttc aggttgtgtg   540
 541 tggttagata tgaaagaatt gggcatcgat gtgcttatta gtgcaccgca aaaaggctgg   600
 601 agtagcacgc catgtgcagg tctggttatg ctgagcgccg ctgccatcaa aaaagtagag   660
 661 agcactgaat ccaactgctt tagtcttgat ctaaagcaat ggttaaccat catgcgtgcg   720
 721 tatgaaaacg gtggtcatgc gtatcatgca accatgccaa ccgatagctt acgtcaattc   780
 781 cgcgatgcta tcttagaggc aaaagagatt ggctttgata tattgcgtga cgcacaatgg   840
 841 gagcttggca accgtgtccg taaggttctg acagataaag gtattgaaag cgttgcagct   900
 901 gaaggttttg aagcgccagg tgttgtggtg tcttacactg agcgtgatga catgcataaa   960
 961 ggtagtgctt tcgctgaagc cggattgcaa atcgctgctg gtgtaccgct aaaagtgggt  1020
1021 gagcctgata acttcaaaac tttccgttta ggtctatttg gtttggataa attgacagac  1080
1081 atcgacggta cggtagagcg ttttgaaaaa gcacttgatg aagtgttagc aaaataa  1137
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
206442 207578 3 Glimmer3 score 13.29 good
Genemark probabilities .96   .99 good
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu