LOADING...
   JCVI_PEP_1096688149193;GN7747A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
JCVI_PEP_1096688149193    GN7747A            JCSG 367491 PDB Deposition 06-DEC-21              PDB id: 2od5

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONJCVI_PEP_1096688149193
DESCRIPTIONPutative nucleic acid binding protein
ORGANISMUnknown
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 2OD5; Identical; 23-JAN-07; HYPOTHETICAL PROTEIN;
DR FFAS; 367491; Fold and function assignment.
DR TVPC; JCVI_PEP_1096688149193; Homologs in PDB, JCSG and SG center.
DR OVP; JCVI_PEP_1096688149193; Ortholog view popup.
DR TPM; JCVI_PEP_1096688149193; Target PDB monitor.
DR FSS; JCVI_PEP_1096688149193; Target function coverage.
PROPERTY Residues: 115 aa
Molecule Weight: 12969.09 Dalton
Isoelectric Point: 5.94
Extinction Coefficient: 19480
Gravy Index: -.57
Number of Met residues: 3
Percentage of Met residues: 2.61 %
Number of Cys residues: 2
Percentage of Cys residues: 1.74 %
SEQUENCE  amino acids 115 aa
>JCVI_PEP_1096688149193  tcag|1096688149193
MTGAVETESMKTVRIREKIKKFLGDRPRNTAEILEHINSTMRHGTTSQQLGNVLSKDKDI
VKVGYIKRSGILSGGYDICEWATRNWVAEHCPEWTEGQPIILNEEGDFTLGPLPE

CDS  cDNA 345 bp
   1 atgactgggg ccgtggagac tgagagcatg aagaccgtcc gcatccgaga gaagatcaag    60
  61 aagttcctag gcgaccgccc gcgcaacacc gcggagatct tggaacacat caacagcacc   120
 121 atgcgtcacg gcaccaccag ccagcagctt ggtaacgtgc tctcgaagga caaagacatc   180
 181 gtcaaggtcg gttacatcaa gcgctcggga atcctctctg gcggctatga catctgcgaa   240
 241 tgggccaccc gcaactgggt cgccgaacac tgccccgaat ggacggaagg gcagcccatc   300
 301 atcctcaacg aagagggtga cttcaccctc ggacctctcc ccgag   345
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu