LOADING...
   JCVI_PEP_1096686650277;GN7729A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
JCVI_PEP_1096686650277    GN7729A            JCSG 380229 PDB Deposition 08-JAN-15              PDB id: 3by7

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONJCVI_PEP_1096686650277
DESCRIPTIONProtein structurally similar to Sm/LSm-like RNA-binding proteins
ORGANISMUnknown
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 3BY7; Identical; 29-JAN-08; UNCHARACTERIZED PROTEIN;
DR FFAS; 367475; Fold and function assignment.
DR TVPC; JCVI_PEP_1096686650277; Homologs in PDB, JCSG and SG center.
DR OVP; JCVI_PEP_1096686650277; Ortholog view popup.
DR TPM; JCVI_PEP_1096686650277; Target PDB monitor.
DR FSS; JCVI_PEP_1096686650277; Target function coverage.
PROPERTY Residues: 103 aa
Molecule Weight: 11404.72 Dalton
Isoelectric Point: 5.75
Extinction Coefficient: 8480
Gravy Index: -.08
Number of Met residues: 3
Percentage of Met residues: 2.91 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 103 aa
>JCVI_PEP_1096686650277  tcag|1096686650277
MKNIKIMRLVTGEDIIGNISESQGLITIKKAFVIIPMQATPGKPVQLVLSPWQPYTDDKE
IVIDDSKVITITSPKDDIIKSYESHTSEIITPSGLITETKIPK

CDS  cDNA 309 bp
   1 atgaaaaata ttaagataat gagattagtc accggtgaag atattatagg caatatatct    60
  61 gaatctcaag gtttaataac aatcaaaaaa gcttttgtaa taattccaat gcaggcaact   120
 121 ccaggaaaac ctgttcaatt ggtgttatca ccttggcaac cttatacaga tgataaggag   180
 181 attgtaattg atgatagtaa agttatcaca attactagtc caaaagatga tattattaaa   240
 241 tcttatgaaa gtcatacaag cgagataata actccatcag gattaattac agaaactaaa   300
 301 ataccaaaa   309
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu