LOADING...
   JCVI_PEP_1096685590403;GN7773A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
JCVI_PEP_1096685590403    GN7773A            JCSG 367457 PDB Deposition 07-APR-09              PDB id: 2pgc

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONJCVI_PEP_1096685590403
DESCRIPTIONMarine metagenome protein with structure similar to oxygenases
ORGANISMUnknown
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 2PGC; Identical; 24-APR-07; UNCHARACTERIZED PROTEIN;
DR FFAS; 367457; Fold and function assignment.
DR TVPC; JCVI_PEP_1096685590403; Homologs in PDB, JCSG and SG center.
DR OVP; JCVI_PEP_1096685590403; Ortholog view popup.
DR TPM; JCVI_PEP_1096685590403; Target PDB monitor.
DR FSS; JCVI_PEP_1096685590403; Target function coverage.
PROPERTY Residues: 206 aa
Molecule Weight: 22963.94 Dalton
Isoelectric Point: 6.83
Extinction Coefficient: 17880
Gravy Index: -.15
Number of Met residues: 8
Percentage of Met residues: 3.88 %
Number of Cys residues: 2
Percentage of Cys residues: 0.97 %
SEQUENCE  amino acids 206 aa
>JCVI_PEP_1096685590403  tcag|1096685590403
MSNINYVILTVASVDFSYRETMARLMSSYSKDLIDNAGAKGTRFGSIGTGDHAGSLIFIQ
FYDDLTGYQKALEIQSKSSVFKEIMDSGKANIYLRNISTSLPTKFEQSYEHPKYIVLTRA
EAAMSDKDKFLNCINDTASCFKDNGALTLRFGNLLTGSNVGNYLLGVGYPSMEAIEKTYD
ELLAHSSYKELMTFAKVNMRNIIKIL

CDS  cDNA 618 bp
   1 atgagtaata ttaattatgt tatattaaca gtagcttcag tggattttag ttacagagaa    60
  61 actatggcta gattaatgtc ttcttattca aaagatttga tagacaacgc tggagcaaaa   120
 121 ggaacacgtt ttggctcaat cggcacagga gaccatgcag gaagtctgat ttttattcaa   180
 181 ttctatgacg acttgactgg ctatcaaaaa gcactggaaa ttcaatcaaa gtcttctgta   240
 241 tttaaagaaa ttatggatag tggaaaggca aatatctatt taagaaatat ttcaacctct   300
 301 ttaccaacaa aatttgaaca aagctatgaa catccaaaat atattgttct tacaagagca   360
 361 gaggctgcaa tgtctgataa agataaattt cttaattgta taaacgacac tgcttcttgt   420
 421 tttaaagata atggcgcctt aacattaaga tttggtaatc tacttactgg ttctaatgtt   480
 481 ggtaattact tacttggagt aggatatcca tccatggaag caatagaaaa aacatatgat   540
 541 gagttattag ctcatagttc atacaaagaa ctcatgactt ttgcgaaagt taatatgagg   600
 601 aacattatta aaatactt   618
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu