LOADING...
   JCVI_PEP_1096682647733;GN7757A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
JCVI_PEP_1096682647733    GN7757A            JCSG 367441 PDB Deposition 06-DEC-21              PDB id: 2od6

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONJCVI_PEP_1096682647733
DESCRIPTIONDimeric ferredoxin-like protein from an environmental metagenome.
ORGANISMUnknown
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 2OD6; Identical; 23-JAN-07; HYPOTHETICAL PROTEIN;
DR FFAS; 367441; Fold and function assignment.
DR TVPC; JCVI_PEP_1096682647733; Homologs in PDB, JCSG and SG center.
DR OVP; JCVI_PEP_1096682647733; Ortholog view popup.
DR TPM; JCVI_PEP_1096682647733; Target PDB monitor.
DR FSS; JCVI_PEP_1096682647733; Target function coverage.
PROPERTY Residues: 109 aa
Molecule Weight: 12625.03 Dalton
Isoelectric Point: 5.46
Extinction Coefficient: 15470
Gravy Index: -.03
Number of Met residues: 6
Percentage of Met residues: 5.50 %
Number of Cys residues: 1
Percentage of Cys residues: 0.92 %
SEQUENCE  amino acids 109 aa
>JCVI_PEP_1096682647733  tcag|1096682647733
MAEPKFTSFTTADFINDVDMELFIDAVEKTAPVWVKEMKSRGLLKFSMNRVWNKGEVFRV
VMTYEYKDRASFEANIAYLEDTFGKNPVFLQLVTTAKFTTSRCLVVMEV

CDS  cDNA 327 bp
   1 atggccgaac caaagtttac cagctttacc actgctgatt ttatcaacga tgttgatatg    60
  61 gaactcttca ttgacgcagt tgaaaagact gcccctgtct gggtcaagga gatgaagtct   120
 121 cgcggcttat taaaatttag catgaacaga gtgtggaaca aaggtgaagt ctttcgggtt   180
 181 gtaatgacct atgaatacaa ggatagggcc tcttttgagg ctaacatagc gtatctagaa   240
 241 gacacctttg gtaaaaaccc cgtctttctg caacttgtca cgacggctaa atttaccaca   300
 301 tcccgttgtc tcgtggtgat ggaggtt   327
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu