LOADING...
   JCVI_PEP_1096672785533;GN7730A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
JCVI_PEP_1096672785533    GN7730A            JCSG 367476 PDB Deposition 07-JAN-26              PDB id: 2op5

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONJCVI_PEP_1096672785533
DESCRIPTIONDimeric ferredoxin-like protein
ORGANISMUnknown
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 2OP5; Identical; 06-FEB-07; HYPOTHETICAL PROTEIN;
DR KEGG; 1.-.-.-; Enzyme page
DR FFAS; 367476; Fold and function assignment.
DR TVPC; JCVI_PEP_1096672785533; Homologs in PDB, JCSG and SG center.
DR OVP; JCVI_PEP_1096672785533; Ortholog view popup.
DR TPM; JCVI_PEP_1096672785533; Target PDB monitor.
DR FSS; JCVI_PEP_1096672785533; Target function coverage.
PROPERTY Residues: 116 aa
Molecule Weight: 13717.99 Dalton
Isoelectric Point: 5.64
Extinction Coefficient: 15470
Gravy Index: -.4
Number of Met residues: 3
Percentage of Met residues: 2.59 %
Number of Cys residues: 1
Percentage of Cys residues: 0.86 %
SEQUENCE  amino acids 116 aa
>JCVI_PEP_1096672785533  tcag|1096672785533
MKDTDETAFLNSLFMDFTSENELELFLKSLDEVWSEDLYSRLSAAGLIRHVISKVWNKEQ
HRISMVFEYDSKEGYQKCQEIIDKEFGITLKEKLKKFVFKIHNNRGVVVSEFIRST

CDS  cDNA 348 bp
   1 atgaaagata ctgatgaaac tgcattcctc aatagtttat ttatggattt cacaagtgaa    60
  61 aatgaacttg aattatttct aaaatctctt gatgaggtct ggtctgaaga cctttattct   120
 121 cgcttatcag cagcaggttt aataagacac gttatctcaa aagtatggaa taaagaacaa   180
 181 cacagaatat cgatggtctt tgaatatgat agcaaagagg gctaccagaa atgtcaggaa   240
 241 atcatcgata aagagtttgg tattactctt aaagaaaaat taaagaaatt tgtctttaaa   300
 301 atacataata atagaggagt tgttgtatct gaatttatta gatctact   348
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu