LOADING...
   JCVI_PEP_1096665735785;GN7738A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
JCVI_PEP_1096665735785    GN7738A            JCSG 367439 PDB Deposition 06-DEC-21              PDB id: 2od4

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONJCVI_PEP_1096665735785
DESCRIPTIONdimeric ferredoxin-like protein
ORGANISMUnknown
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR PDB; 2OD4; Identical; 23-JAN-07; HYPOTHETICAL PROTEIN;
DR FFAS; 367439; Fold and function assignment.
DR TVPC; JCVI_PEP_1096665735785; Homologs in PDB, JCSG and SG center.
DR OVP; JCVI_PEP_1096665735785; Ortholog view popup.
DR TPM; JCVI_PEP_1096665735785; Target PDB monitor.
DR FSS; JCVI_PEP_1096665735785; Target function coverage.
PROPERTY Residues: 100 aa
Molecule Weight: 11464.61 Dalton
Isoelectric Point: 6.57
Extinction Coefficient: 11460
Gravy Index: -.12
Number of Met residues: 4
Percentage of Met residues: 4.00 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 100 aa
>JCVI_PEP_1096665735785  tcag|1096665735785
MFAGSIPMYIRVVSITAQSKLQFDMTVTYFENVWSPKVISLGAISAEFVQSNENSGMYII
HYPDKQTAISVFDKIKPEVDEVRTQNRIQITEGKRLFRVD

CDS  cDNA 300 bp
   1 atgtttgcag ggagtatacc gatgtacatt agagtcgtct ccatcaccgc acaatctaag    60
  61 ttacagtttg atatgacagt tacttatttt gaaaacgtgt ggtcgccaaa ggttataagc   120
 121 ctaggcgcaa tttcagccga atttgttcaa agtaatgaga actctggaat gtacattatc   180
 181 cattacccag ataagcaaac tgcaatttct gtatttgata agattaagcc tgaagttgac   240
 241 gaggttcgca cccaaaatcg tattcaaatt actgaaggca agaggctatt cagggtggac   300
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu