LOADING...
   CE12432
Protein Sequence Comparative Analysis   (PSCA)
CE12432                JCSG

Protein Sequence Information


ACCESSIONCE12432
DESCRIPTIONHomeobox protein vab-7.
ORGANISMCaenorhabditis elegans
COMMENT-!- FUNCTION: REQUIRED FOR POSTERIOR-SPECIFIC PATTERN FORMATION IN THE
EMBRYO AND MAY HAVE A ROLE IN REGULATING EGL-5 EXPRESSION.
-!- SUBCELLULAR LOCATION: NUCLEAR.
-!- DEVELOPMENTAL STAGE: EMBRYO, L1 AND L2 LARVAE.
-!- SIMILARITY: BELONGS TO THE EVEN-SKIPPED HOMEOBOX FAMILY.
PROTEINS.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; VAB7_CAEEL
DR SPTR; Q93899 (flat text); Q93899 (good view)
DR GenBank; CAA97809
PROPERTY Residues: 247 aa
Molecule Weight: 26817.19 Dalton
Isoelectric Point: 8.78
Extinction Coefficient: 26930
Gravy Index: -.71
Number of Met residues: 9
Percentage of Met residues: 3.64 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 247 aa
>CE12432  M142.4 CE12432 locus:vab-7 homeobox protein (even-skipped subfamily) (HINXTON) SW:Q93899 protein_id:
MQSFDIESLIGVNKVPSLVEMVAASRASSFSPPFEQQHHDPMGVVAAAAAAAAAGRHHPY
DNRDDGQMRRYRTAFSREQIGRLEREFAKENYVSRKTRGELAAELNLPEGTIKVWFQNRR
MKDKRQRVGGLAWPFPPQMAAYMLNPFAYEMWMKTAAASQFGATGPGNGAYGNNGSSTSP
SAAGSLPFLPPLGFPSFLSQNSTKSPSSPHSDDSSKSKNTSSDDDESKPVNFSNSPSSSS
PSPYSTD
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu