LOADING...
   CE05656
Protein Sequence Comparative Analysis   (PSCA)
CE05656                JCSG

Protein Sequence Information


ACCESSIONCE05656
DESCRIPTIONProbable elongation factor 1-gamma (EF-1-gamma) (eEF-1B gamma).
ORGANISMCaenorhabditis elegans
COMMENT-!- FUNCTION: PROBABLY PLAYS A ROLE IN ANCHORING THE COMPLEX TO OTHER
CELLULAR COMPONENTS.
-!- SUBUNIT: EF-1 IS COMPOSED OF FOUR SUBUNITS: ALPHA, BETA, DELTA,
AND GAMMA.
-!- SIMILARITY: CONTAINS 1 GST-LIKE DOMAIN.
-!- SIMILARITY: CONTAINS 1 EF-1-GAMMA DOMAIN.
--------------------------------------------------------------------------
This SWISS-PROT entry is copyright. It is produced through a collaboration
between the Swiss Institute of Bioinformatics and the EMBL outstation -
the European Bioinformatics Institute. There are no restrictions on its
use by non-profit institutions as long as its content is in no way
modified and this statement is not removed. Usage by and for commercial
entities requires a license agreement (See http://www.isb-sib.ch/announce/
or send an email to license@isb-sib.ch).
--------------------------------------------------------------------------
DR UNIPROT; EF1G_CAEEL
DR SPTR; P54412 (flat text); P54412 (good view)
DR GenBank; CAA96631
PROPERTY Residues: 398 aa
Molecule Weight: 44385.19 Dalton
Isoelectric Point: 6.29
Extinction Coefficient: 74370
Gravy Index: -.36
Number of Met residues: 6
Percentage of Met residues: 1.51 %
Number of Cys residues: 2
Percentage of Cys residues: 0.50 %
SEQUENCE  amino acids 398 aa
>CE05656  F17C11.9 CE05656 elongation factor 1-gamma (HINXTON) SW:P54412 protein_id:CAA96631.1
MTGKLYGNKDNFRTQKVLIAAKLANKTVTLAGDAAPADKFPLGVTPAFEGDALLFGAESI
GLHLTGTSANAETVQWLQFAEGYLLPAVLGYVLPSVSAANFDKKTVEQYKNELNGQLQVL
DRVLVKKTYLVGERLSLADVSVALDLLPAFQYVLDANARKSIVNVTRWFRTVVNQPAVKE
VLGEVSLASSVAQFNQAKFTELSAKVAKSAPKAEKPKKEAKPAAAAAQPEDDEPKEEKSK
DPFQDMPKGTFVLDNFKRSYSNEDTATKAIPHFWENFDADNWSIWKCEYKYPEDLTLAFM
SCNLINGMYQRLEKLKKNAFASMILFGTDNNSTISGIWVWKGDKLAFELSPDWQVDYESY
TWTKLDAKSDATKKEVNEYLMWEGDFGGKKFNQGKIFK
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu