LOADING...
   BC111065;WT2735B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC111065    WT2735B.AIFM1            JCSG 422903 PDB Deposition 13-JUL-02              PDB id: 4lii

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONBC111065
DESCRIPTIONApoptosis-inducing factor, mitochondrion-associated, 1, Flavoprotein, FAD/NAD-linked reductases
ORGANISMHomo sapiens
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF07992; Pyr_redox_2;
DR Pfam; PF00070; Pyr_redox;
DR PDB; 4LII; Identical; 04-SEP-13; APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL;
DR PDB; 4BUR; Identical; 09-JUL-14; APOPTOSIS INDUCING FACTOR 1, MITOCHONDRIAL;
DR PDB; 1M6I; Identical; 28-AUG-02; PROGRAMMED CELL DEATH PROTEIN 8;
DR PDB; 4BV6; Identical; 17-SEP-14; APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL;
DR PDB; 4FDC; Identical; 17-OCT-12; APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL;
DR PDB; 3GD4; Identical; 19-MAY-09; APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL;
DR PDB; 3GD3; Identical; 19-MAY-09; APOPTOSIS-INDUCING FACTOR 1, MITOCHONDRIAL;
DR PDB; 1GV4; Identical; 26-APR-02; PROGRAMED CELL DEATH PROTEIN 8;
DR FFAS; 422901; Fold and function assignment.
DR TVPC; BC111065; Homologs in PDB, JCSG and SG center.
DR OVP; BC111065; Ortholog view popup.
DR TPM; BC111065; Target PDB monitor.
DR FSS; BC111065; Target function coverage.
PROPERTY Residues: 609 aa
Molecule Weight: 66291.19 Dalton
Isoelectric Point: 9.03
Extinction Coefficient: 60850
Gravy Index: -.27
Number of Met residues: 10
Percentage of Met residues: 1.64 %
Number of Cys residues: 5
Percentage of Cys residues: 0.82 %
SEQUENCE  amino acids 609 aa
>BC111065  BC111065 Homo sapiens apoptosis-inducing factor, mitochondrion-associated, 1, mRNA (cDNA clone MGC:1
MFRCGGLAAGALKQKLVPLVRTVCVRSPRQRNRLPVVQSHHLGSPSRSLASTGASGKDGS
NLVYFLIVGATVTGAGVYYAYKTMKEDEKRYNERISGLGLTPEQKQKKAALSASEGEEVP
QDKAPSHVPFLLIGGGTAAFAAARSIRARDPGARVLIVSEDPELPYMRPPLSKELWFSDD
PNVTKTLRFKQWNGKERSIYFQPPSFYVSAQDLPHIENGGVAVLTGKKVVQLDVRDNMVK
LNDGSQITYEKCLIATGGTPRSLSAIDRAGAEVKSRTTLFRKIGDFRSLEKISREVKSIT
IIGGGFLGSELACALGRKARALGTEVIQLFPEKGNMGKILPEYLSNWTMEKVRREGVKVM
PNAIVQSVGVSSGKLLIKLKDGRKVETDHIVAAVGLEPNVELAKTGGLEIDSDFGGFRVN
AELQARSNIWVAGDAACFYDIKLGRRRVEHHDHAVVSGRLAGENMTGAAKPYWHQSMFWS
DLGPDVGYEAIGLVDSSLPTVGVFAKATAQDNPKSATEQSGTGIRSESETESEASEITIP
PSTPAVPQAPVQGEDYGKGVIFYLRDKVVVGIVLWNIFNRMPIARKIIKDGEQHEDLNEV
AKLFNIHED

CDS  cDNA 1830 bp
   1 atgttccggt gtggaggcct ggcggcgggt gctttgaagc agaagctggt gcccttggtg    60
  61 cggaccgtgt gcgtccgaag cccgaggcag aggaaccggc tcccagttgt gcagtctcat   120
 121 cacctaggat ccccttctag atcactagca tctacaggtg cttctgggaa agatggcagc   180
 181 aacctagtgt acttcttaat tgtaggagca acagtcactg gggcaggagt ttattatgcc   240
 241 tacaagacta tgaaagagga cgaaaaaaga tacaatgaaa gaatttcagg gttagggctg   300
 301 acaccagaac agaaacagaa aaaggccgcg ttatctgctt cagaaggaga ggaagttcct   360
 361 caagacaagg cgccaagtca tgttcctttc ctgctaattg gtggaggcac agctgctttt   420
 421 gctgcagcca gatccatccg ggctcgggat cctggggcca gggtactgat tgtatctgaa   480
 481 gatcctgagc tgccgtacat gcgacctcct ctttcaaaag aactgtggtt ttcagatgac   540
 541 ccaaatgtca caaagacact gcgattcaaa cagtggaatg gaaaagagag aagcatatat   600
 601 ttccagccac cttctttcta tgtctctgct caggacctgc ctcatattga gaatggtggt   660
 661 gtggctgtcc tcactgggaa gaaggtagta cagctggatg tgagagacaa catggtgaaa   720
 721 cttaatgatg gctctcaaat aacctatgaa aagtgcttga ttgcaacagg aggtactcca   780
 781 agaagtctgt ctgccattga tagggctgga gcagaggtga agagtagaac aacgcttttc   840
 841 agaaagattg gagactttag aagcttggag aagatttcac gggaagtcaa atcaattacg   900
 901 attatcggtg ggggcttcct tggtagcgaa ctggcctgtg ctcttggcag aaaggctcga   960
 961 gccttgggca cagaagtgat tcaactcttc cccgagaaag gaaatatggg aaagatcctc  1020
1021 cccgaatacc tcagcaactg gaccatggaa aaagtcagac gagagggggt taaggtgatg  1080
1081 cccaatgcta ttgtgcaatc cgttggagtc agcagtggca agttacttat caagctgaaa  1140
1141 gacggcagga aggtagaaac tgaccacata gtggcagctg tgggcctgga gcccaatgtt  1200
1201 gagttggcca agactggtgg cctggaaata gactcagatt ttggtggctt ccgggtaaat  1260
1261 gcagagctac aagcacgctc taacatctgg gtggcaggag atgctgcatg cttctacgat  1320
1321 ataaagttgg gaaggaggcg ggtagagcac catgatcacg ctgttgtgag tggaagattg  1380
1381 gctggagaaa atatgactgg agctgctaag ccgtactggc atcagtcaat gttctggagt  1440
1441 gatttgggcc ccgatgttgg ctatgaagct attggtcttg tggacagtag tttgcccaca  1500
1501 gttggtgttt ttgcaaaagc aactgcacaa gacaacccca aatctgccac agagcagtca  1560
1561 ggaactggta tccgatcaga gagtgagaca gagtccgagg cctcagaaat tactattcct  1620
1621 cccagcaccc cggcagttcc acaggctccc gtccaggggg aggactacgg caaaggtgtc  1680
1681 atcttctacc tcagggacaa agtggtcgtg gggattgtgc tatggaacat ctttaaccga  1740
1741 atgccaatag caaggaagat cattaaggac ggtgagcagc atgaagatct caatgaagta  1800
1801 gccaaactat tcaacattca tgaagactga  1830
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu