LOADING...
   BC060828;RG20614A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC060828    RG20614A.ARID3A            JCSG 421838 PDB Deposition 13-JUL-05              PDB id: 4ljx

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONBC060828
DESCRIPTIONCASP Target
Description Hidden
ORGANISMHomo sapiens
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF01388; ARID;
DR PDB; 4LJX; Identical; 28-AUG-13; AT-RICH INTERACTIVE DOMAIN-CONTAINING PROTEIN 3A;
DR PDB; 2KK0; Identical; 14-JUL-09; AT-RICH INTERACTIVE DOMAIN-CONTAINING PROTEIN 3A;
DR FFAS; 421820; Fold and function assignment.
DR TVPC; BC060828; Homologs in PDB, JCSG and SG center.
DR OVP; BC060828; Ortholog view popup.
DR TPM; BC060828; Target PDB monitor.
DR FSS; BC060828; Target function coverage.
PROPERTY Residues: 593 aa
Molecule Weight: 62956.45 Dalton
Isoelectric Point: 4.82
Extinction Coefficient: 31400
Gravy Index: -.65
Number of Met residues: 19
Percentage of Met residues: 3.20 %
Number of Cys residues: 1
Percentage of Cys residues: 0.17 %
SEQUENCE  amino acids 593 aa
>BC060828  BC060828 Homo sapiens AT rich interactive domain 3A (BRIGHT-like), mRNA (cDNA clone MGC:71697 IMAGE:
MKLQAVMETLLQRQQRARQELEARQQLPPDPPAAPHGRARAAPDEDREPESARMQRAQMA
ALAAMRAAAAGLGHPASPGGSEDGPPGSEEEDAAREGTPGSPGRGREGPGEEHFEDMASD
EDMKPKWEEEEMEEDLGEDEEEEEEDYEDEEEEEDEEGLGPPGPASLGTTALFPRKAQPP
QAFRGDGVPRVLGGQERPGPGPAHPGGAAHVAPQLQPPDHGDWTYEEQFKQLYELDGDPK
RKEFLDDLFSFMQKRGTPVNRIPIMAKQVLDLFMLYVLVTEKGGLVEVINKKLWREITKG
LNLPTSITSAAFTLRTQYMEYLYPYECEKRGLSNPNELQAAIDSNRREGRRQSFGGSLFA
YSPGGAHGMLSSPKLPVSSLGLAASTNGSSITPAPKIKKEEDSAIPITVPGRLPVSLAGH
PVVAAQAAAVQAAAAQAAVAAQAAALEQLREKLESAEPPEKKMALVADEQQRLMQRALQQ
NFLAMAAQLPMSIRINSQASESRQDSAVNLTGTNGSNSISMSVEINGIMYTGVLFAQPPA
PTPTSAPNKGGGGGGSSSSNAGGRGGNTGTSGGQAGPAGLSTPSTSTSNNSLP

CDS  cDNA 1782 bp
   1 atgaaactac aggccgtgat ggagacgctg ttgcagcggc agcagcgggc gcgccaggag    60
  61 ctggaggccc ggcagcagct gccccccgat ccccctgctg caccccacgg ccgggcccgg   120
 121 gctgcccccg acgaggacag agagcccgaa agtgcccgga tgcagcgggc tcagatggcc   180
 181 gcactggcag ccatgcgggc tgcagctgcg ggcctgggac acccggccag ccccggcggc   240
 241 tctgaggatg ggcccccagg ctcggaggag gaggacgcgg cccgggaggg gacaccgggc   300
 301 tcacccgggc gaggcagaga agggccagga gaggagcact ttgaggacat ggcctccgac   360
 361 gaggacatga agcccaaatg ggaggaggag gagatggagg aagacctcgg ggaggatgag   420
 421 gaggaggagg aggaggatta cgaggatgag gaggaggagg aggacgagga ggggctgggc   480
 481 cccccaggcc ctgccagctt gggcaccacg gcactgttcc cccgaaaggc ccagccaccc   540
 541 caggccttcc gcggcgatgg cgttcccagg gtgctggggg gccaggagcg gccggggcct   600
 601 ggccctgccc accccggagg ggccgcccac gtagccccgc agctgcagcc gcctgaccac   660
 661 ggcgactgga cttacgagga gcagtttaag cagctctacg aactcgacgg ggaccccaag   720
 721 aggaaggaat tcctggatga cttgttcagc ttcatgcaga agcgagggac acctgtgaac   780
 781 cgcatcccca tcatggccaa acaggtcctt gacctgttca tgctgtacgt gctggtgacg   840
 841 gagaagggcg gcctcgtgga ggtcatcaac aagaagctgt ggcgtgagat caccaagggc   900
 901 ctcaacctgc ccacgtccat caccagtgca gccttcaccc tgcggaccca atacatggag   960
 961 tacctgtacc cctacgagtg tgagaagcgg ggcctcagta accccaatga gctccaggca  1020
1021 gccatagaca gcaaccgacg ggagggccgg cgccagagct ttggtggctc cctctttgcc  1080
1081 tactcgccag gcggggcaca cggcatgctc tcctcaccca agctacccgt gtcctccctg  1140
1141 ggcctggccg caagcaccaa cggcagctcc atcacccccg cccctaagat caagaaagag  1200
1201 gaggactcag ccatccccat cacagtccct ggccgcctgc ctgtgtccct ggcgggccac  1260
1261 cctgtggtgg cagcccaggc agcagctgtg caagcagcag ccgcccaagc agctgtggct  1320
1321 gcacaggcag ctgccctgga acagctgcgg gagaagctgg agtctgcgga gcctccggag  1380
1381 aagaagatgg ccctggtggc cgatgagcag caacggctga tgcaacgtgc actccagcag  1440
1441 aacttcctgg ccatggcggc ccagctgccc atgagcattc ggatcaacag ccaagcctcc  1500
1501 gaaagccgcc aggactctgc tgtgaacctg acgggcacca acggcagcaa cagcatcagc  1560
1561 atgtcggtgg agatcaacgg catcatgtac acaggagttc tgtttgctca gccgccggcc  1620
1621 cccacgccaa cctctgctcc caacaaagga ggcggcggcg gcggcagcag cagcagcaac  1680
1681 gcaggcggcc ggggaggaaa caccggaacc agcggcggcc aggctgggcc agcggggctg  1740
1741 tccacaccct ccacatctac ctcaaataac tcgttgcctt aa  1782
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu