LOADING...
   BC047029;WT20695A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC047029    WT20695A.NUP35            JCSG 422743 PDB Deposition 13-JUL-03              PDB id: 4lir

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONBC047029
DESCRIPTIONNucleoporin 35kDa, PF05172 family, Nup53/35/40-type RNA recognition motif
ORGANISMHomo sapiens
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF05172; Nup35_RRM;
DR PDB; 4LIR; Identical; 11-SEP-13; NUCLEOPORIN NUP53;
DR PDB; 1WWH; Identical; 05-JUL-05; NUCLEOPORIN 35;
DR FFAS; 422742; Fold and function assignment.
DR TVPC; BC047029; Homologs in PDB, JCSG and SG center.
DR OVP; BC047029; Ortholog view popup.
DR TPM; BC047029; Target PDB monitor.
DR FSS; BC047029; Target function coverage.
PROPERTY Residues: 326 aa
Molecule Weight: 34771.83 Dalton
Isoelectric Point: 9.15
Extinction Coefficient: 28420
Gravy Index: -.27
Number of Met residues: 15
Percentage of Met residues: 4.60 %
Number of Cys residues: 2
Percentage of Cys residues: 0.61 %
SEQUENCE  amino acids 326 aa
>BC047029  BC047029 Homo sapiens nucleoporin 35kDa, mRNA (cDNA clone MGC:51954 IMAGE:5541023), complete cds, co
MAAFAVEPQGPALGSEPMMLGSPTSPKPGVNAQFLPGFLMGDLPAPVTPQPRSISGPSVG
VMEMRSPLLAGGSPPQPVVPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRRQPNISVMQ
SPLVGVTSTPGTGQSMFSPASIGQPRKTTLSPAQLDPFYTQGDSLTSEDHLDDSWVTVFG
FPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARKALSKDGRIFGESIMIGV
KPCIDKSVMESSDRCALSSPSLAFTPPIKTLGTPTQPGSTPRISTMRPLATAYKASTSDY
QVISDRQTPKKDESLVSKAMEYMFGW

CDS  cDNA 981 bp
   1 atggcagcct ttgcagtgga acctcagggg cccgcgttag gatctgaacc aatgatgctg    60
  61 ggttcaccca catctccaaa gccaggagtt aatgcccagt tcttacctgg atttttaatg   120
 121 ggggatttgc cagctccggt gactccacaa cctcgatcaa ttagtggccc ttcagtagga   180
 181 gtaatggaaa tgagatcacc tttacttgca ggtgggtcac caccacaacc agttgtacca   240
 241 gctcataaag ataaaagtgg cgctccacca gttagaagta tatatgatga catttctagc   300
 301 ccaggacttg gatcaacacc tttaacttca agaagacagc caaacatttc agtaatgcag   360
 361 agtcctcttg ttggagttac atctactcct ggaacagggc aaagtatgtt tagtccagca   420
 421 agtatcggtc agccacgaaa gacgacatta tctcctgccc agttggatcc tttttatact   480
 481 caaggagatt ctttgacttc agaagatcac ctcgatgact cttgggtgac tgtatttggg   540
 541 tttcctcaag catctgcttc ctacatatta ctacaatttg cacagtatgg gaatatctta   600
 601 aaacatgtga tgtctaatac aggaaattgg atgcatattc gttatcaatc taaactgcag   660
 661 gctcggaaag ccttaagcaa agatgggagg atttttggag aatccatcat gattggtgta   720
 721 aaaccatgta ttgacaaaag tgttatggaa agcagtgaca gatgtgcttt atcatctcca   780
 781 tctttagcct ttacaccacc aatcaaaact ctaggtacac caacacaacc tggaagtact   840
 841 cctaggattt ctaccatgag acctcttgct acagcataca aagcctctac tagtgattat   900
 901 caggttattt ctgacagaca aacgccaaaa aaagatgaaa gtcttgtatc caaagcaatg   960
 961 gagtacatgt ttggctggta g   981
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu