LOADING...
   BC043071;BC043071
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC043071    WT4514D.U2AF2            JCSG 429861 PDB Deposition 13-FEB-12

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONBC043071
DESCRIPTIONCASP Target
Description Hidden
ORGANISMMus musculus
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00076; RRM_1;
DR PDB; 2YH0; Identical; 20-JUL-11; SPLICING FACTOR U2AF 65 KDA SUBUNIT;
DR PDB; 2YH1; Identical; 20-JUL-11; SPLICING FACTOR U2AF 65 KDA SUBUNIT;
DR PDB; 2G4B; Identical; 25-JUL-06; SPLICING FACTOR U2AF 65 KDA SUBUNIT;
DR PDB; 3VAF; Identical; 13-FEB-13; SPLICING FACTOR U2AF 65 KDA SUBUNIT;
DR PDB; 3VAG; Identical; 13-FEB-13; SPLICING FACTOR U2AF 65 KDA SUBUNIT;
DR PDB; 3VAH; Identical; 13-FEB-13; SPLICING FACTOR U2AF 65 KDA SUBUNIT;
DR PDB; 3VAI; Identical; 13-FEB-13; SPLICING FACTOR U2AF 65 KDA SUBUNIT;
DR PDB; 3VAJ; Identical; 13-FEB-13; SPLICING FACTOR U2AF 65 KDA SUBUNIT;
DR FFAS; 422734; Fold and function assignment.
DR TVPC; BC043071; Homologs in PDB, JCSG and SG center.
DR OVP; BC043071; Ortholog view popup.
DR TPM; BC043071; Target PDB monitor.
DR FSS; BC043071; Target function coverage.
PROPERTY Residues: 471 aa
Molecule Weight: 53117.85 Dalton
Isoelectric Point: 9.18
Extinction Coefficient: 28880
Gravy Index: -.59
Number of Met residues: 16
Percentage of Met residues: 3.40 %
Number of Cys residues: 6
Percentage of Cys residues: 1.27 %
SEQUENCE  amino acids 471 aa
>BC043071  BC043071 Mus musculus U2 small nuclear ribonucleoprotein auxiliary factor (U2AF) 2, mRNA (cDNA clone
MSDFDEFERQLNENKQERDKENRHRKRSHSRSRSRDRKRRSRSRDRRNRDQRSASRDRRR
RSKPLTRGAKEEHGGLIRSPRHEKKKKVRKYWDVPPPGFEHITPMQYKAMQAAGQIPATA
LLPTMTPDGLAVTPTPVPVVGSQMTRQARRLYVGNIPFGITEEAMMDFFNAQMRLGGLTQ
APGNPVLAVQINQDKNFAFLEFRSVDETTQAMAFDGIIFQGQSLKIRRPHDYQPLPGMSE
NPSVYVPGVVSTVVPDSAHKLFIGGLPNYLNDDQVKELLTSFGPLKAFNLVKDSATGLSK
GYAFCEYVDINVTDQAIAGLNGMQLGDKKLLVQRASVGAKNATLSTINQTPVTLQVPGLM
SSQVQMGGHPTEVLCLMNMVLPEELLDDEEYEEIVEDVRDECSKYGLVKSIEIPRPVDGV
EVPGCGKIFVEFTSVFDCQKAMQGLTGRKFANRVVVTKYCDPDSYHRRDFW

CDS  cDNA 1416 bp
   1 atgtcggact tcgacgagtt cgagcggcag ctcaacgaga ataaacaaga gcgggacaag    60
  61 gagaatcggc acaggaagcg tagtcacagt cgctctcgaa gccgagatcg aaagcgcagg   120
 121 agcaggagcc gagatcggcg caaccgggac cagcgcagtg cctctcggga taggagacga   180
 181 cgaagcaaac ctttgaccag aggcgctaaa gaggagcacg gtggattgat tcgttctccc   240
 241 cgccatgaga agaagaagaa ggtgcgtaaa tactgggacg tgccaccgcc tggctttgag   300
 301 cacatcaccc caatgcagta caaggccatg caagctgcgg gtcagattcc agccactgcc   360
 361 cttctcccga ccatgactcc tgatggtctg gctgtgaccc caacgccagt gcctgtggtt   420
 421 gggagccaga tgaccagaca ggccagacgt ctctacgtgg gcaacatccc ttttggcatt   480
 481 actgaggagg ctatgatgga cttcttcaac gcccagatgc gcttgggagg gttgactcag   540
 541 gcccctggca acccagtctt ggctgtgcag ataaatcaag acaagaattt tgcctttttg   600
 601 gagttccggt cagtggatga gacgacccag gccatggcat ttgatggcat catcttccag   660
 661 ggccagtcat tgaagattcg aaggcctcat gactatcagc cattgcctgg catgtcagag   720
 721 aacccctctg tttatgtgcc tggagttgta tccactgtag tcccagattc tgcccacaag   780
 781 ctgttcatcg ggggtttgcc caattaccta aatgatgacc aggtaaaaga gctgctgaca   840
 841 tcctttgggc ctctcaaggc cttcaacttg gttaaggata gtgccacagg gctctccaag   900
 901 ggctatgcct tctgtgagta cgtggacatc aacgtcacag atcaggccat tgcggggctg   960
 961 aatgggatgc agctagggga caagaagctg cttgtccaga gggcgagtgt gggagccaag  1020
1021 aatgccacgc tgagcaccat caatcagaca cctgtgaccc ttcaagtgcc cggcctgatg  1080
1081 agctctcagg tgcagatggg cggtcaccca actgaggtcc tgtgcctcat gaacatggtg  1140
1141 ctgcctgagg agctgctgga cgatgaggag tatgaggaga ttgtagagga cgtacgagac  1200
1201 gagtgcagca agtatgggtt ggtcaaatcc attgaaattc cccgccccgt ggacggcgtc  1260
1261 gaggtgcctg gctgtggaaa gatcttcgtg gagttcacct ctgtgtttga ctgccagaaa  1320
1321 gccatgcagg gtctaaccgg tcgcaagttc gccaacagag tggtggtcac aaaatactgt  1380
1381 gaccctgatt cttaccaccg tcgggacttc tggtag  1416
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu