LOADING...
   BC030493;WS20613E
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC030493    WS20613E.RBM39            JCSG 421759 PDB Deposition 13-FEB-08              PDB id: 3s6e, 4j5o, 2lq5

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONBC030493
DESCRIPTIONRNA binding motif protein 39 (RBM39), ferredoxin-like fold
ORGANISMMus musculus
COMMENTSequence HHpred, against pfam, top hit RNA recognition motif (PF00076, Prob 99.4, E-val 7E-13)

Structure
FATCAT, against scop, top matches with RNA-binding domain, RBD - Scop code d.58.7.1 - (e.g.
top d2dita1, P-value 2.56e-08)
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00076; RRM_1;
DR PDB; 4OZ0; Identical; 14-MAY-14; RNA-BINDING PROTEIN 39;
DR PDB; 4OZ1; Identical; 14-MAY-14; RNA-BINDING PROTEIN 39;
DR PDB; 2LQ5; Identical; 07-MAR-12; RNA-BINDING PROTEIN 39;
DR PDB; 3S6E; Identical; 15-JUN-11; RNA-BINDING PROTEIN 39;
DR PDB; 4J5O; Identical; 10-APR-13; RNA-BINDING PROTEIN 39;
DR PDB; 4RU2; Identical; 04-FEB-15; RNA-BINDING PROTEIN 39 (RBM39);
DR PDB; 5CXT; Identical; 14-OCT-15; RNA-BINDING PROTEIN 39;
DR PDB; 2JRS; Identical; 04-SEP-07; RNA-BINDING PROTEIN 39;
DR FFAS; 421605; Fold and function assignment.
DR TVPC; BC030493; Homologs in PDB, JCSG and SG center.
DR OVP; BC030493; Ortholog view popup.
DR TPM; BC030493; Target PDB monitor.
DR FSS; BC030493; Target function coverage.
PROPERTY Residues: 367 aa
Molecule Weight: 39816.16 Dalton
Isoelectric Point: 6.12
Extinction Coefficient: 21430
Gravy Index: -.13
Number of Met residues: 13
Percentage of Met residues: 3.54 %
Number of Cys residues: 4
Percentage of Cys residues: 1.09 %
SEQUENCE  amino acids 367 aa
>BC030493  BC030493 Mus musculus RNA binding motif protein 39, mRNA (cDNA clone MGC:40964 IMAGE:5400675), compl
MQLAARIRPRDLEEFFSTVGKVRDVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQR
VLGVPIIVQASQAEKNRAAAMANNLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIE
SIQLMMDSETGRSKGYGFITFSDSECAKKALEQLNGFELAGRPMKVGHVTERTDASSASS
FLDSDELERTGIDLGTTGRLQLMARLAEGTGLQIPPAAQQALQMSGSLAFGAVADLQTRL
SQQTEASALAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHI
YVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQ
LLVPSRR

CDS  cDNA 1104 bp
   1 atgcaactgg cagcaagaat tcgaccgaga gatttggaag agtttttctc tacagttgga    60
  61 aaggttcgag atgtgagaat gatttctgat agaaattcaa gacgttccaa aggaattgca   120
 121 tatgtggaat ttgttgatgt cagttcagtg cctctagcaa ttggattaac tggccaacga   180
 181 gttttaggag tgccaatcat agttcaggca tcacaggcag aaaaaaacag agctgctgca   240
 241 atggcaaaca atttacaaaa gggaagtgct ggacctatga ggctctatgt aggctcatta   300
 301 cactttaaca taactgaaga catgcttcgg gggatctttg aaccttttgg aaggattgaa   360
 361 agtattcagc tcatgatgga tagtgaaact ggccgatcta agggatatgg atttattaca   420
 421 ttttctgact cagaatgtgc caaaaaggct ttggaacaac tgaatggatt tgagttagct   480
 481 gggagaccaa tgaaagttgg tcacgttact gaacgaactg atgcttcgag tgctagttca   540
 541 tttttggaca gtgacgaact agaaaggact ggaattgact tgggaacaac tggacgtctt   600
 601 cagttaatgg caagacttgc ggagggtacc ggtttgcaga ttccacctgc cgcacaacaa   660
 661 gcattacaaa tgagtggctc tctggcattt ggtgctgtgg cagatttgca aacacgactt   720
 721 tcccaacaga ccgaagcctc agctttagct gcagctgcgt ctgttcaacc tcttgcaaca   780
 781 cagtgtttcc aactttctaa catgtttaat cctcaaacag aagaagaagt tggatgggat   840
 841 acagagatta aagatgatgt cattgaagaa tgtaataaac atggaggagt cattcatatt   900
 901 tatgttgata aaaattcagc tcagggcaat gtgtatgtga agtgcccatc tattgctgcg   960
 961 gctattgctg ctgtcaatgc attgcatggc agatggtttg ctggtaaaat gataacagca  1020
1021 gcgtatgtac ctcttccaac ttaccacaac ctctttcctg attctatgac agcaacacaa  1080
1081 ctactggttc caagtagacg atga  1104
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu