LOADING...
   BC024153;BC024153
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC024153    WS2513B.RBM10            JCSG 429910 PDB Deposition 15-JAN-16

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONBC024153
DESCRIPTIONNMR structure of the N-terminal RNA Binding domain 1
ORGANISMHomo sapiens
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF01585; G-patch;
DR Pfam; PF00641; zf-RanBP;
DR Pfam; PF00076; RRM_1;
DR PDB; 2M2B; Identical; 16-JAN-13; RNA-BINDING PROTEIN 10;
DR PDB; 2LXI; Identical; 10-OCT-12; RNA-BINDING PROTEIN 10;
DR PDB; 2MXW; Identical; 01-APR-15; RNA-BINDING PROTEIN 10;
DR PDB; 2MXV; Identical; 28-JAN-15; RNA-BINDING PROTEIN 10;
DR FFAS; 421602; Fold and function assignment.
DR TVPC; BC024153; Homologs in PDB, JCSG and SG center.
DR OVP; BC024153; Ortholog view popup.
DR TPM; BC024153; Target PDB monitor.
DR FSS; BC024153; Target function coverage.
PROPERTY Residues: 930 aa
Molecule Weight: 103527.21 Dalton
Isoelectric Point: 5.69
Extinction Coefficient: 108070
Gravy Index: -1.04
Number of Met residues: 18
Percentage of Met residues: 1.94 %
Number of Cys residues: 6
Percentage of Cys residues: 0.65 %
SEQUENCE  amino acids 930 aa
>BC024153  BC024153 Homo sapiens RNA binding motif protein 10, mRNA (cDNA clone MGC:16349 IMAGE:3845258), compl
MEYERRGGRGDRTGRYGATDRSQDDGGENRSRDHDYRDMDYRSYPREYGSQEGKHDYDDS
SEEQSAEDSYEASPGSETQRRRRRRHRHSPTGPPGFPRDGDYRDQDYRTEQGEEEEEEED
EEEEEKASNIVMLRMLPQAATEDDIRGQLQSHGVQAREVRLMRNKSSGQSRGFAFVEFSH
LQDATRWMEANQHSLNILGQKVSMHYSDPKPKINEDWLCNKCGVQNFKRREKCFKCGVPK
SEAEQKLPLGTRLDQQTLPLGGRELSQGLLPLPQPYQAQGVLASQALSQGSEPSSENAND
TIILRNLNPHSTMDSILGALAPYAVLSSSNVRVIKDKQTQLNRGFAFIQLSTIVEAAQLL
QILQALHPPLTIDGKTINVEFAKGSKRDMASNEGSRISAASVASTAIAAAQWAISQASQG
GEGTWATSEEPPVDYSYYQQDEGYGNSQGTESSLYAHGYLKGTKGPGITGTKGDPTGAGP
EASLEPGADSVSMQAFSRAQPGAAPGIYQQSAEASSSQGTAANSQSYTIMSPAVLKSELQ
SPTHPSSALPPATSPTAQESYSQYPVPDVSTYQYDETSGYYYDPQTGLYYDPNSQYYYNA
QSQQYLYWDGERRTYVPALEQSADGHKETGAPSKEGKEKKEKHKTKTAQQIAKDMERWAR
SLNKQKENFKNSFQPISSLRDDERRESATADAGYAILEKKGALAERQHTSMDLPKLASDD
RPSPPRGLVAAYSGESDSEEEQERGGPEREEKLTDWQKLACLLCRRQFPSKEALIRHQQL
SGLHKQNLEIHRRAHLSENELEALEKNDMEQMKYRDRAAERREKYGIPEPPEPKRRKYGG
ISTASVDFEQPTRDGLGSDNIGSRMLQAMGWKEGSGLGRKKQGIVTPIEAQTRVRGSGLG
ARGSSYGVTSTESYKETLHKTMVTRFNEAQ

CDS  cDNA 2793 bp
   1 atggagtatg aaagacgtgg tggtcgtggt gacaggactg gccgctatgg agccactgac    60
  61 cgctcgcagg atgatggtgg ggagaaccgc agccgagacc acgactaccg ggacatggac   120
 121 taccgttcat atcctcgcga gtatggcagc caggagggca agcatgacta tgacgactca   180
 181 tctgaggagc agagtgcgga ggattcctac gaggcctccc cgggctccga gactcagcgt   240
 241 aggcggcggc ggcggcacag gcacagcccc accggcccgc caggcttccc ccgagacggc   300
 301 gactatcggg accaggacta tcggaccgag caaggggagg aggaggagga ggaggaggat   360
 361 gaggaggagg aggagaaggc cagtaacatc gtcatgctga ggatgctgcc acaggcagcc   420
 421 actgaggatg acatccgtgg ccagctgcag tcgcacggcg tgcaagcacg ggaggttcgg   480
 481 ctgatgcgga acaaatcttc aggtcagagc cggggcttcg ccttcgtcga gtttagtcac   540
 541 ttgcaggacg ctacacgatg gatggaagcc aatcagcact ccctcaacat cctgggccag   600
 601 aaggtgtcga tgcactacag tgaccccaag cccaagatca atgaggactg gctgtgcaat   660
 661 aagtgtggcg tccagaactt caaacgccga gagaagtgct tcaaatgtgg cgtgcccaag   720
 721 tcagaggcag agcagaagct gcccctcggc acgaggctgg atcagcagac actgccactg   780
 781 ggtggccggg agctgagcca gggcctgctt cccctgccgc agccctacca ggcccaggga   840
 841 gtcctggcct cccaagccct gtcacagggc tcggagccaa gctcagagaa cgccaatgac   900
 901 accatcattt tgcgcaacct gaacccacac agcaccatgg attccatcct gggggccctg   960
 961 gcaccctacg cggtgctgtc ctcctccaac gtgcgcgtca taaaggacaa gcagacccaa  1020
1021 ctgaaccgcg gctttgcctt catccagctc tccaccatcg tggaggcagc ccagctgctg  1080
1081 cagatcctgc aggccctgca cccaccactc actatcgacg gcaagaccat caatgttgag  1140
1141 tttgccaagg gttctaagag ggacatggcc tccaatgaag gcagtcgcat cagtgctgcc  1200
1201 tctgtggcca gcactgccat tgctgcggcc cagtgggcca tctcacaggc ctcccaaggt  1260
1261 ggggagggta cctgggccac ctccgaggag ccgccggtcg actacagcta ctaccaacag  1320
1321 gatgagggct atggcaacag ccagggcaca gagtcttccc tctatgccca tggctacctc  1380
1381 aagggcacca agggccctgg catcactgga accaaagggg atcccactgg agcaggtccc  1440
1441 gaggcctccc tagagcctgg ggccgactct gtgtcgatgc aggctttctc tcgcgcccag  1500
1501 cctggtgctg ctcctggcat ctaccaacaa tcagccgagg cgagcagtag ccagggcact  1560
1561 gctgccaaca gccagtcgta taccatcatg tcacccgctg tgctcaaatc tgagctccag  1620
1621 agccctaccc atcctagttc tgctctccca ccggctacca gccccactgc ccaggaatcc  1680
1681 tacagccagt accctgttcc cgacgtctct acctaccagt acgatgagac ctccggctac  1740
1741 tactatgacc cccagaccgg cctctactat gaccccaact cccagtatta ctacaatgct  1800
1801 cagagccagc agtacctgta ctgggatggg gagaggcgga cctatgttcc cgccctggag  1860
1861 cagtcggccg acggacataa ggagacaggg gcaccctcga aggagggcaa agagaagaag  1920
1921 gagaagcaca agaccaagac agctcaacag attgccaagg acatggaacg ctgggcccgc  1980
1981 agtctcaaca aacaaaaaga aaacttcaaa aatagcttcc agcctatcag ctccctgcga  2040
2041 gatgacgaga ggcgggagtc agccactgca gatgctggct atgccatcct cgagaagaag  2100
2101 ggagcactag ccgagagaca gcacaccagc atggatctcc cgaaattggc cagtgacgac  2160
2161 cgcccaagcc ctccgcgagg actggtggca gcctacagcg gggagagtga cagtgaggag  2220
2221 gagcaggagc gtgggggccc tgagcgggag gagaagctca ccgactggca gaagctggcc  2280
2281 tgtctgctct gccgacgcca gttccccagc aaagaggcgc tcatccggca ccagcagctc  2340
2341 tcagggctcc acaagcaaaa ccttgagatt caccggcgag cccacttgtc agaaaacgag  2400
2401 ctagaagcac tagagaagaa tgacatggag caaatgaagt accgggaccg tgcagctgaa  2460
2461 cgcagagaaa agtatggcat ccccgagccg ccagagccca agaggaggaa gtacggcggc  2520
2521 atatccacag cctctgtaga cttcgagcag cctactcggg acgggctggg cagtgacaac  2580
2581 attggcagtc ggatgctgca ggccatgggc tggaaagagg gcagcggcct gggccgcaag  2640
2641 aagcagggca ttgtaacgcc tatcgaggcc caaacacggg tgcggggctc cggcctgggt  2700
2701 gcacggggca gctcctacgg ggtcacctca accgagtcct acaaggagac actgcacaag  2760
2761 acaatggtga cccgcttcaa cgaggcccag tga  2793
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu