LOADING...
   BC017247;BC017247
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC017247    WT2603C.FUBP1            JCSG 425403 PDB Deposition 13-JUL-02

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONBC017247
DESCRIPTIONFar upstream element (FUSE) binding protein 1, KH domain, PF00013
ORGANISMHomo sapiens
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00013; KH_1;
DR Pfam; PF09005; DUF1897;
DR PDB; 1J4W; Identical; 06-MAR-02; FUSE BINDING PROTEIN;
DR PDB; 4LIJ; Identical; 27-NOV-13; FAR UPSTREAM ELEMENT-BINDING PROTEIN 1;
DR PDB; 1X4N; Identical; 14-NOV-05; FAR UPSTREAM ELEMENT BINDING PROTEIN 1;
DR PDB; 1X4M; Identical; 14-NOV-05; FAR UPSTREAM ELEMENT BINDING PROTEIN 1;
DR PDB; 2KXH; Identical; 18-AUG-10; POLY(U)-BINDING-SPLICING FACTOR PUF60;
DR FFAS; 422634; Fold and function assignment.
DR TVPC; BC017247; Homologs in PDB, JCSG and SG center.
DR OVP; BC017247; Ortholog view popup.
DR TPM; BC017247; Target PDB monitor.
DR FSS; BC017247; Target function coverage.
PROPERTY Residues: 653 aa
Molecule Weight: 68601.18 Dalton
Isoelectric Point: 6.85
Extinction Coefficient: 67270
Gravy Index: -.72
Number of Met residues: 15
Percentage of Met residues: 2.30 %
Number of Cys residues: 4
Percentage of Cys residues: 0.61 %
SEQUENCE  amino acids 653 aa
>BC017247  BC017247 Homo sapiens far upstream element (FUSE) binding protein 1, mRNA (cDNA clone MGC:29580 IMAG
MADYSTVPPPSSGSAGGGGGGGGGGGVNDAFKDALQRARQIAAKIGGDAGTSLNSNDYGY
GGQKRPLEDGDQPDAKKVAPQNDSFGTQLPPMHQQQRSVMTEEYKVPDGMVGFIIGRGGE
QISRIQQESGCKIQIAPDSGGLPERSCMLTGTPESVQSAKRLLDQIVEKGRPAPGFHHGD
GPGNAVQEIMIPASKAGLVIGKGGETIKQLQERAGVKMVMIQDGPQNTGADKPLRITGDP
YKVQQAKEMVLELIRDQGGFREVRNEYGSRIGGNEGIDVPIPRFAVGIVIGRNGEMIKKI
QNDAGVRIQFKPDDGTTPERIAQITGPPDRCQHAAEIITDLLRSVQAGNPGGPGPGGRGR
GRGQGNWNMGPPGGLQEFNFIVPTGKTGLIIGKGGETIKSISQQSGARIELQRNPPPNAD
PNMKLFTIRGTPQQIDYARQLIEEKIGGPVNPLGPPVPHGPHGVPGPHGPPGPPGPGTPM
GPYNPAPYNPGPPGPAPHGPPAPYAPQGWGNAYPHWQQQAPPDPAKAGTDPNSAAWAAYY
AHYYQQQAQPPPAAPAGAPTTTQTNGQGDQQNPAPAGQVDYTKAWEEYYKKMGQAVPAPT
GAPPGGQPDYSAAWAEYYRQQAAYYAQTSPQGMPQHPPAPQCRFDPASIELAL

CDS  cDNA 1962 bp
   1 atggcagact attcaacagt gcctcccccc tcttctggct cagctggtgg cggtggtggc    60
  61 ggcggtggtg gtggaggagt taacgacgct ttcaaagatg cactgcagag agcccggcag   120
 121 attgcagcaa aaattggagg tgatgcaggg acatcactga attcaaatga ctatggttat   180
 181 gggggacaaa aaagaccttt agaagatgga gatcaaccag atgctaagaa agttgctcct   240
 241 caaaatgact cttttggaac acagttacca ccgatgcatc agcagcaaag atctgtaatg   300
 301 acagaagaat acaaagttcc agatggaatg gttggattca taattggcag aggaggtgaa   360
 361 cagatctcac gcatacaaca ggaatctgga tgcaaaatac agatagctcc tgacagtggt   420
 421 ggccttccag aaaggtcctg tatgttaact ggaacacctg aatctgtcca gtcagcaaaa   480
 481 cggttactgg accagattgt tgaaaaagga agaccagctc ctggcttcca tcatggcgat   540
 541 ggaccgggaa atgcagttca agaaatcatg attccagcta gcaaggcagg attagtcatt   600
 601 ggaaaagggg gagaaactat taaacagctt caggaacggg ctggagttaa aatggttatg   660
 661 attcaagacg ggccgcagaa cactggtgct gacaaacctc ttaggattac aggagaccca   720
 721 tataaagttc aacaagccaa ggaaatggtg ttagagttaa ttcgtgatca aggcggtttc   780
 781 agagaagttc ggaatgagta tgggtcaaga ataggaggaa atgaagggat agatgtcccc   840
 841 attccaagat ttgctgttgg cattgtaata ggaagaaatg gagagatgat caaaaaaata   900
 901 caaaatgatg ctggtgttcg cattcagttt aagccagatg atgggacaac acccgaaagg   960
 961 atagcacaaa taacaggacc tccagaccga tgtcaacatg ctgcagaaat tattacagac  1020
1021 cttcttcgaa gtgttcaggc tggtaatcct ggtggacctg gacctggtgg tcgaggaaga  1080
1081 ggtagaggtc aaggcaactg gaacatggga ccacctggtg gactacagga atttaatttt  1140
1141 attgtgccaa ctgggaaaac tggattaata ataggaaaag gaggtgaaac cataaaaagc  1200
1201 ataagccagc agtctggtgc aagaatagaa cttcagagaa atcctccacc aaatgcagat  1260
1261 cctaatatga agttatttac aattcgtggc actccacaac agatagacta tgctcggcaa  1320
1321 ctcatagaag aaaagattgg tggcccagta aatcctttag ggccacctgt accccatggg  1380
1381 ccccatggtg tcccaggccc ccatggacct cctgggcctc cagggcctgg aactccaatg  1440
1441 ggaccataca accctgcacc ttataatcct ggaccaccag gcccggctcc tcatggtcct  1500
1501 ccagccccat atgctcccca gggatgggga aatgcatatc cacactggca gcagcaggct  1560
1561 cctcctgatc cagctaaggc aggaacggat ccaaattcag cagcttgggc tgcttattac  1620
1621 gctcactatt atcaacagca agcacagcca ccaccagcag cccctgcagg tgcaccaact  1680
1681 acaactcaaa ctaatggaca aggagatcag cagaatccag ccccagctgg acaggttgat  1740
1741 tataccaagg cttgggaaga gtactacaag aaaatgggtc aggcagttcc tgctccgact  1800
1801 ggggctcctc caggtggtca gccagattat agtgcagcct gggctgagta ttatagacaa  1860
1861 caagcagcct attatgccca gacaagtccc cagggaatgc cacagcatcc tccagcacct  1920
1921 cagtgcaggt ttgatccagc cagtatagaa ctagctctgt ag  1962
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu