LOADING...
   BC013200;WT2001B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC013200    WT2001B.LCK            JCSG 422603 PDB Deposition 12-JAN-10              PDB id: 4d8k

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONBC013200
DESCRIPTIONBC013200 Homo sapiens lymphocyte-specific protein tyrosine kinase,
src-Family Kinases are nonreceptor tyrosine kinases that are reported to be critical for cancer progression.
Protein kinase has SH2, SH3 and Pkinase_Tyr domains (PF00017 , PF00018, PF07714).
ORGANISMHomo sapiens
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF07714; Pkinase_Tyr;
DR Pfam; PF00017; SH2;
DR Pfam; PF00069; Pkinase;
DR Pfam; PF00018; SH3_1;
DR Pfam; PF07653; SH3_2;
DR PDB; 3BYS; Identical; 16-SEP-08; PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK;
DR PDB; 3BYU; Identical; 16-SEP-08; PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK;
DR PDB; 2PL0; Identical; 09-OCT-07; PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK;
DR PDB; 2ZM1; Identical; 14-OCT-08; PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK;
DR PDB; 2ZM4; Identical; 14-OCT-08; PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK;
DR PDB; 2ZYB; Identical; 03-FEB-09; PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK;
DR PDB; 3AC1; Identical; 30-JUN-10; PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK;
DR PDB; 3AC2; Identical; 30-JUN-10; PROTO-ONCOGENE TYROSINE-PROTEIN KINASE LCK;
DR FFAS; 422601; Fold and function assignment.
DR TVPC; BC013200; Homologs in PDB, JCSG and SG center.
DR OVP; BC013200; Ortholog view popup.
DR TPM; BC013200; Target PDB monitor.
DR FSS; BC013200; Target function coverage.
PROPERTY Residues: 539 aa
Molecule Weight: 61187.04 Dalton
Isoelectric Point: 5.11
Extinction Coefficient: 94310
Gravy Index: -.45
Number of Met residues: 11
Percentage of Met residues: 2.04 %
Number of Cys residues: 9
Percentage of Cys residues: 1.67 %
SEQUENCE  amino acids 539 aa
>BC013200  BC013200 Homo sapiens lymphocyte-specific protein tyrosine kinase, mRNA (cDNA clone MGC:17196 IMAGE:
MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL
VRLYAVVTQEPIYIITEYMENDTLLDSQLEEKGLGASPWGNLGQQLLLLPTGSLVDFLKT
PSGIKLTINKLLDMAAQIAEGMAFIEERNYIHRDLRAANILVSDTLSCKIADFGLARLIE
DNEYTAREGAKFPIKWTAPEAINYGTFTIKSDVWSFGILLTEIVTHGRIPYPGMTNPEVI
QNLERGYRMVRPDNCPEELYQLMRLCWKERPEDRPTFDYLRSVLEDFFTATEGQYQPQP

CDS  cDNA 1620 bp
   1 atgggctgtg gctgcagctc acacccggaa gatgactgga tggaaaacat cgatgtgtgt    60
  61 gagaactgcc attatcccat agtcccactg gatggcaagg gcacgctgct catccgaaat   120
 121 ggctctgagg tgcgggaccc actggttacc tacgaaggct ccaatccgcc ggcttcccca   180
 181 ctgcaagaca acctggttat cgctctgcac agctatgagc cctctcacga cggagatctg   240
 241 ggctttgaga agggggaaca gctccgcatc ctggagcaga gcggcgagtg gtggaaggcg   300
 301 cagtccctga ccacgggcca ggaaggcttc atccccttca attttgtggc caaagcgaac   360
 361 agcctggagc ccgaaccctg gttcttcaag aacctgagcc gcaaggacgc ggagcggcag   420
 421 ctcctggcgc ccgggaacac tcacggctcc ttcctcatcc gggagagcga gagcaccgcg   480
 481 ggatcgtttt cactgtcggt ccgggacttc gaccagaacc agggagaggt ggtgaaacat   540
 541 tacaagatcc gtaatctgga caacggtggc ttctacatct cccctcgaat cacttttccc   600
 601 ggcctgcatg aactggtccg ccattacacc aatgcttcag atgggctgtg cacacggttg   660
 661 agccgcccct gccagaccca gaagccccag aagccgtggt gggaggacga gtgggaggtt   720
 721 cccagggaga cgctgaagct ggtggagcgg ctgggggctg gacagttcgg ggaggtgtgg   780
 781 atggggtact acaacgggca cacgaaggtg gcggtgaaga gcctgaagca gggcagcatg   840
 841 tccccggacg ccttcctggc cgaggccaac ctcatgaagc agctgcaaca ccagcggctg   900
 901 gttcggctct acgctgtggt cacccaggag cccatctaca tcatcactga atacatggag   960
 961 aatgacacac ttctagactc ccagttggag gagaaaggtc tgggggcctc cccctggggc  1020
1021 aacttgggcc agcaactctt gcttctgccc acagggagtc tagtggattt tctcaagacc  1080
1081 ccttcaggca tcaagttgac catcaacaaa ctcctggaca tggcagccca aattgcagaa  1140
1141 ggcatggcat tcattgaaga gcggaattat attcatcgtg accttcgggc tgccaacatt  1200
1201 ctggtgtctg acaccctgag ctgcaagatt gcagactttg gcctagcacg cctcattgag  1260
1261 gacaacgagt acacagccag ggagggggcc aagtttccca ttaagtggac agcgccagaa  1320
1321 gccattaact acgggacatt caccatcaag tcagatgtgt ggtcttttgg gatcctgctg  1380
1381 acggaaattg tcacccacgg ccgcatccct tacccaggga tgaccaaccc ggaggtgatt  1440
1441 cagaacctgg agcgaggcta ccgcatggtg cgccctgaca actgtccaga ggagctgtac  1500
1501 caactcatga ggctgtgctg gaaggagcgc ccagaggacc ggcccacctt tgactacctg  1560
1561 cgcagtgtgc tggaggactt cttcacggcc acagagggcc agtaccagcc tcagccttga  1620
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu