LOADING...
   BC011707;KN.B21268A.NRBF2
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC011707    KN.B21268A.NRBF2            JCSG 429611 PDB Deposition 15-APR-20              PDB id: 4zey

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONBC011707
DESCRIPTIONCASP Target
Description Hidden
ORGANISMHomo sapiens
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF08961; DUF1875;
DR PDB; 2CRB; Identical; 20-NOV-05; NUCLEAR RECEPTOR BINDING FACTOR 2;
DR FFAS; 429611; Fold and function assignment.
DR TVPC; BC011707; Homologs in PDB, JCSG and SG center.
DR OVP; BC011707; Ortholog view popup.
DR TPM; BC011707; Target PDB monitor.
DR FSS; BC011707; Target function coverage.
PROPERTY Residues: 287 aa
Molecule Weight: 32375.93 Dalton
Isoelectric Point: 5.61
Extinction Coefficient: 22460
Gravy Index: -.76
Number of Met residues: 6
Percentage of Met residues: 2.09 %
Number of Cys residues: 3
Percentage of Cys residues: 1.05 %
SEQUENCE  amino acids 287 aa
>BC011707  BC011707 Homo sapiens nuclear receptor binding factor 2, mRNA (cDNA clone MGC:19778 IMAGE:3687848), 
MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQ
RDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYS
PSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKR
HVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATAS
STWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGFMNN

CDS  cDNA 864 bp
   1 atggaagtaa tggaaggacc cctcaacctg gctcatcaac agagcagacg agcagaccgt    60
  61 ttattagctg caggcaaata cgaagaggct atttcttgtc acaaaaaggc tgcagcatat   120
 121 ctttctgaag ccatgaagct gacacagtca gagcaggctc atctttcact ggaattgcaa   180
 181 agggatagcc atatgaaaca gctcctcctc atccaagaga gatggaaaag ggcccagcgt   240
 241 gaagaaagat tgaaagccca gcagaacaca gacaaggatg cagctgccca tcttcagaca   300
 301 tctcacaaac cctctgcaga ggatgcagag ggccagagtc ccctttctca gaagtacagc   360
 361 ccttccacag agaaatgcct gcctgagatt caggggatct ttgacaggga tccagacaca   420
 421 ctactttatt tacttcagca aaagagtgag ccagcagagc catgtattgg aagcaaagcc   480
 481 ccaaaagatg ataaaacaat tatagaggag caggcaacca aaattgcaga tttgaagagg   540
 541 catgtggaat tccttgtggc tgagaatgaa agattaagga aagaaaataa acaactaaag   600
 601 gctgaaaagg ccagacttct aaaaggtcca atagaaaagg agctggatgt agatgctgat   660
 661 tttgtagaaa cgtcagagtt atggagcttg ccaccacatg cagaaactgc tacagcctcc   720
 721 tcaacctggc agaagttcgc agcaaatact gggaaagcca aggacattcc aatccccaat   780
 781 cttcctccct tggattttcc atctccagaa cttcctctta tggagctctc tgaggatatt   840
 841 ctgaaaggat ttatgaataa ttaa   864
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu