LOADING...
   BC011564;RF20603A.DAX1
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC011564    RF20603A.DAX1            JCSG 421170 PDB Deposition 14-DEC-05

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONBC011564
DESCRIPTIONBC011564 Homo sapiens nuclear receptor subfamily 0, group B, member 1, mRNA (cDN
A clone MGC:20161 IMAGE:4637694), complete cds, coding region:13-1425
ORGANISMHOMO SAPIENS
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00104; Hormone_recep;
DR PDB; 3F5C; Highly similar; 23-DEC-08; NUCLEAR RECEPTOR SUBFAMILY 5 GROUP A MEMBER 2;
DR PDB; 4NUF; Highly similar; 29-JAN-14; MALTOSE ABC TRANSPORTER PERIPLASMIC PROTEIN, NUCL RECEPTOR S;
DR FFAS; 421170; Fold and function assignment.
DR TVPC; BC011564; Homologs in PDB, JCSG and SG center.
DR OVP; BC011564; Ortholog view popup.
DR TPM; BC011564; Target PDB monitor.
DR FSS; BC011564; Target function coverage.
PROPERTY Residues: 470 aa
Molecule Weight: 51714.84 Dalton
Isoelectric Point: 8.47
Extinction Coefficient: 74370
Gravy Index: -.18
Number of Met residues: 11
Percentage of Met residues: 2.34 %
Number of Cys residues: 23
Percentage of Cys residues: 4.89 %
SEQUENCE  amino acids 470 aa
>BC011564  BC011564 Homo sapiens nuclear receptor subfamily 0, group B, member 1, mRNA (cDNA clone MGC:20161 IM
MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVGREGLLGGRNV
ALLYRCCFCGKDHPRQGSILYSMLTSAKQTYAAPKAPEATLGPCWGCSCGSDPGVGRAGL
PGGRPVALLYRCCFCGEDHPRQGSILYSLLTSSKQTHVAPAAPEARPGGAWWDRSYFAQR
PGGKEALPGGRATALLYRCCFCGEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSS
GALRPVALKSPQVVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLMLELA
QDRLQFETVEVSEPSMLQKILTTRRRETGGNEPLPVPTLQHHLAPPAEARKVPSASQVQA
IKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYIQGLQWGTQQILSEHTRMTHQ
GPHDRFIELNSTLFLLRFINANVIAELFFRPIIGTVSMDDMMLEMLCTKI

CDS  cDNA 1413 bp
   1 atggcgggcg agaaccacca gtggcagggc agcatcctct acaacatgct tatgagcgcg    60
  61 aagcaaacgc gcgcggctcc tgaggctcca gagacgcggc tggtggatca gtgctggggc   120
 121 tgttcgtgcg gcgatgagcc cggggtgggc agagaggggc tgctgggcgg gcggaacgtg   180
 181 gcgctcctgt accgctgctg cttttgcggt aaagaccacc cacggcaggg cagcatcctc   240
 241 tacagcatgc tgacgagcgc aaagcaaacg tacgcggcac cgaaggcgcc cgaggcgacg   300
 301 ctgggtccgt gctggggctg ttcgtgcggc tctgatcccg gggtgggcag agcggggctt   360
 361 ccgggtgggc ggcccgtggc actcctgtac cgctgctgct tttgtggtga agaccacccg   420
 421 cggcagggca gcatcctcta cagcttgctc actagctcaa agcaaacgca cgtggctccg   480
 481 gcagcgcccg aggcacggcc agggggcgcg tggtgggacc gctcctactt cgcgcagagg   540
 541 ccagggggta aagaggcgct accaggcggg cgggccacgg cgcttctgta ccgctgctgc   600
 601 ttttgcggtg aagaccaccc gcagcagggc agcaccctct actgcgtgcc cacgagcaca   660
 661 aatcaagcgc aggcggctcc ggaggagcgg ccgagggccc cctggtggga cacctcctct   720
 721 ggtgcgctgc ggccggtggc gctcaagagt ccacaggtgg tctgcgaggc agcctcagcg   780
 781 ggcctgttga agacgctgcg cttcgtcaag tacttgccct gcttccaggt gctgcccctg   840
 841 gaccagcagc tggtgctggt gcgcaactgc tgggcgtccc tgctcatgct tgagctggcc   900
 901 caggaccgct tgcagttcga gactgtggaa gtctcggagc ccagcatgct gcagaagatc   960
 961 ctcaccacca ggcggcggga gaccgggggc aacgagccac tgcccgtgcc cacgctgcag  1020
1021 caccatttgg caccgccggc ggaggccagg aaggtgccct ccgcctccca ggtccaagcc  1080
1081 atcaagtgct ttctttccaa atgctggagt ctgaacatca gtaccaagga gtacgcctac  1140
1141 ctcaagggga ccgtgctctt taacccggac gtgccgggcc tgcagtgcgt gaagtacatt  1200
1201 cagggactcc agtggggaac tcagcaaata ctcagtgaac acaccaggat gacgcaccaa  1260
1261 gggccccatg acagattcat cgaacttaat agtacccttt tcctgctgag attcatcaat  1320
1321 gccaatgtca ttgctgaact gttcttcagg cccatcatcg gcacagtcag catggatgat  1380
1381 atgatgctgg aaatgctctg tacaaagata taa  1413
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu