LOADING...
   BC009808;SC.A20848A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC009808    SC.A20848A            JCSG 424755 PDB Deposition 14-JAN-23              PDB id: 4ole

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONBC009808
DESCRIPTIONCASP Target
Description Hidden
ORGANISMHomo sapiens
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00564; PB1;
DR PDB; 4OLE; Identical; 19-FEB-14; NEXT TO BRCA1 GENE 1 PROTEIN;
DR PDB; 2G4S; Identical; 20-FEB-07; NEXT TO BRCA1 GENE 1 PROTEIN;
DR PDB; 1WJ6; Identical; 29-NOV-04; KIAA0049 PROTEIN;
DR PDB; 2BKF; Identical; 18-JAN-06; ZINC-FINGER PROTEIN NBR1 (NEXT TO BREAST CANCER 1);
DR FFAS; 424755; Fold and function assignment.
DR TVPC; BC009808; Homologs in PDB, JCSG and SG center.
DR OVP; BC009808; Ortholog view popup.
DR TPM; BC009808; Target PDB monitor.
DR FSS; BC009808; Target function coverage.
PROPERTY Residues: 937 aa
Molecule Weight: 103828.81 Dalton
Isoelectric Point: 5.06
Extinction Coefficient: 81360
Gravy Index: -.47
Number of Met residues: 17
Percentage of Met residues: 1.81 %
Number of Cys residues: 20
Percentage of Cys residues: 2.13 %
SEQUENCE  amino acids 937 aa
>BC009808  BC009808 Homo sapiens neighbor of BRCA1 gene 1, mRNA (cDNA clone MGC:1377 IMAGE:2989212), complete c
MEPQVTLNVTFKNEIQSFLVSDPENTTWADIEAMVKVSFDLNTIQIKYLDEENEEVSINS
QGEYEEALKMAVKQGNQLQMQVHEGHHVVDEAPPPVVGAKRLAARAGKKPLAHYSSLVRV
LGSDMKTPEDPAVQSFPLVPCDTDQPQDKPPDWFTSYLETFREQVVNETVEKLEQKLHEK
LVLQNPSLGSCPSEVSMPTSEETLFLPENQFSWHIACNNCQRRIVGVRYQCSLCPSYNIC
EDCEAGPYGHDTNHVLLKLRRPVVGSSEPFCHSKYSTPRLPAALEQVRLQKQVDKNFLKA
EKQRLRAEKKQRKAEVKELKKQLKLHRKIHLWNSIHGLQSPKSPLGRPESLLQSNTLMLP
LQPCTSVMPMLSAAFVDENLPDGTHLQPGTKFIKHWRMKNTGNVKWSADTKLKFMWGNLT
LASTEKKDVLVPCLKAGHVGVVSVEFIAPALEGTYTSHWRLSHKGQQFGPRVWCSIIVDP
FPSEESPDNIEKGMISSSKTDDLTCQQEETFLLAKEERQLGEVTEQTEGTAACIPQKAKN
VASERELYIPSVDLLTAQDLLSFELLDINIVQELERVPHNTPVDVTPCMSPLPHDSPLIE
KPGLGQIEEENEGAGFKALPDSMVSVKRKAENIASVEEAEEDLSGTQFVCETVIRSLTLD
AAPDHNPPCRQKSLQMTFALPEGPLGNEKEEIIHIAEEEAVMEEEEDEEDEEEEDELKDE
VQSQSSASSEDYIIILPECFDTSRPLGDSMYSSALSQPGLERGAEGKPGVEAGQEPAEAG
ERLPGGENQPQEHSISDILTTSQTLETVPLIPEVVELPPSLPRSSPCVHHHGSPGVDLPV
TIPEVSSVPDQIRGEPRGSSGLVNSRQKSYDHSRHHHGSSIAGGLVKGALSVAASAYKAL
FAGPPVTAQGLWGLLSFLHLAKKCFFLKAPSEAFSWF

CDS  cDNA 2814 bp
   1 atggaaccac aggttactct aaatgtgact tttaaaaatg aaattcaaag ctttctggtt    60
  61 tctgatccag aaaatacaac ttgggctgat atcgaagcta tggtaaaagt ttcatttgat   120
 121 ctgaatacta ttcaaataaa atacctggat gaggaaaatg aagaggtatc catcaacagt   180
 181 caaggagaat atgaagaagc gcttaagatg gcagttaaac agggaaacca actgcagatg   240
 241 caagtccacg aagggcacca tgtcgttgat gaagccccac ccccagttgt aggagcaaaa   300
 301 cgactagctg ccagggcagg gaagaagcca cttgcacatt actcttcact ggtgagagtc   360
 361 ttgggatcag acatgaagac cccagaggat cctgcagtgc agtcgtttcc acttgttcca   420
 421 tgtgacacag accagcctca agacaagccc ccagactggt tcacaagcta cctggagacg   480
 481 ttcagagaac aagtggttaa cgaaacggtt gagaagcttg aacagaaatt acatgaaaag   540
 541 cttgtcctcc agaacccatc cttgggttct tgtccctcag aagtctcaat gcctacttca   600
 601 gaagaaacat tgtttttgcc agaaaaccag ttcagctggc atattgcttg caacaactgc   660
 661 caaagaagga ttgttggtgt ccgctaccag tgtagcctat gcccatccta caatatctgt   720
 721 gaagattgtg aagcagggcc atatggccat gacactaacc acgtcctgct gaagttgcgg   780
 781 agacctgttg tgggctcctc tgaaccgttc tgtcactcaa agtactctac tcctcgtctt   840
 841 cctgctgctc tggaacaagt caggctccag aaacaggttg ataagaactt tcttaaagca   900
 901 gaaaagcaaa ggttgcgagc tgagaagaaa caacgtaaag cagaggtcaa ggaacttaaa   960
 961 aagcagctta aactccatag gaaaattcac ctgtggaatt caatccatgg actccagagc  1020
1021 cccaagtctc ctttaggccg acctgagagc ttgctccagt ctaataccct gatgctccct  1080
1081 ttgcagccct gtacctccgt tatgccaatg ctcagtgcag catttgtgga tgagaatttg  1140
1141 cctgatggga ctcaccttca gccaggaacc aagtttatca aacactggag gatgaaaaat  1200
1201 acaggaaatg taaagtggag tgcagacaca aagctcaagt tcatgtgggg aaacctgact  1260
1261 ttggcttcca cagaaaagaa ggatgttttg gttccctgcc tcaaggccgg ccatgtggga  1320
1321 gttgtatctg tggagttcat tgccccagcc ttggagggaa cgtatacttc ccattggcgt  1380
1381 ctttctcaca aaggccagca atttgggcct cgggtctggt gcagtatcat agtagatcct  1440
1441 ttcccctccg aagagagccc tgataacatt gaaaagggca tgatcagctc aagcaaaact  1500
1501 gatgatctca cctgccagca agaggaaact tttcttctgg ctaaagaaga aagacagctt  1560
1561 ggtgaagtga ctgagcagac agaagggaca gcagcctgca tcccacagaa ggcaaaaaat  1620
1621 gttgccagtg agagggagct ctacatccca tctgtggatc ttctgactgc ccaggacctg  1680
1681 ctgtcctttg agctgttgga tataaacatt gttcaagagt tggagagagt gccccacaac  1740
1741 acccctgtgg atgtgactcc ctgcatgtct cctctgccac atgacagtcc tttaatagag  1800
1801 aagccaggct tggggcagat agaggaagag aatgaagggg caggatttaa agcacttcct  1860
1861 gattctatgg tgtcagtaaa gaggaaggct gagaacattg cttctgtgga ggaagcagaa  1920
1921 gaagacctga gtgggaccca gtttgtgtgt gagacagtaa tccgatccct taccttggat  1980
1981 gctgccccag accacaaccc tccttgcaga cagaagtcct tgcagatgac atttgccttg  2040
2041 cctgaaggac cacttggaaa tgagaaggag gagattatcc atatcgctga ggaagaagct  2100
2101 gtcatggagg aggaggagga tgaggaggat gaggaggagg aggatgagct caaagatgaa  2160
2161 gttcaaagtc agtcctctgc ttcctcagag gattacatca tcatcctgcc tgagtgcttt  2220
2221 gataccagcc gccccctggg ggattctatg tacagctctg cgctctcaca gccaggcctg  2280
2281 gagcgaggtg ctgaaggcaa gcctggggtt gaggctgggc aggaaccagc tgaggctggg  2340
2341 gaaagactcc ctggagggga gaaccagcca caggagcaca gcataagtga catcctcacg  2400
2401 acctcacaga ctctggaaac agtgccccta atcccagagg tagtggagct tccaccgtca  2460
2461 ctgcccagga gctctccttg tgtacatcat catggttccc caggagtgga tttaccagtt  2520
2521 accataccag aagtttcttc agtccctgat cagatcagag gagagcccag aggctcatca  2580
2581 ggacttgtaa acagcagaca gaagagctat gaccactcaa ggcaccatca tgggagcagc  2640
2641 attgctggag gactggtgaa gggggctttg tctgttgctg cctctgcata caaggccctg  2700
2701 tttgctgggc caccagtcac tgcacagggt ctctggggct tgctgtcatt ccttcatctg  2760
2761 gccaaaaaat gcttcttcct gaaagccccg agtgaagcat tctcctggtt ctaa  2814
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu