LOADING...
   BC008053;WS.A20810A.DMAP1
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC008053    WS.A20810A.DMAP1            JCSG 423958 PDB Deposition 12-DEC-13              PDB id: 4iej

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONBC008053
DESCRIPTIONDNA methyltransferase 1 associated protein 1, DNA methylation, chromatin regulator, repressor
ORGANISMHomo sapiens
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF05499; DMAP1;
DR PDB; 3HM5; Identical; 16-JUN-09; DNA METHYLTRANSFERASE 1-ASSOCIATED PROTEIN 1;
DR PDB; 4IEJ; Identical; 02-JAN-13; DNA METHYLTRANSFERASE 1-ASSOCIATED PROTEIN 1;
DR FFAS; 423954; Fold and function assignment.
DR TVPC; BC008053; Homologs in PDB, JCSG and SG center.
DR OVP; BC008053; Ortholog view popup.
DR TPM; BC008053; Target PDB monitor.
DR FSS; BC008053; Target function coverage.
PROPERTY Residues: 467 aa
Molecule Weight: 52989.8 Dalton
Isoelectric Point: 9.51
Extinction Coefficient: 42860
Gravy Index: -.82
Number of Met residues: 8
Percentage of Met residues: 1.71 %
Number of Cys residues: 3
Percentage of Cys residues: 0.64 %
SEQUENCE  amino acids 467 aa
>BC008053  BC008053 Homo sapiens DNA methyltransferase 1 associated protein 1, mRNA (cDNA clone MGC:16289 IMAGE
MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRPEGMHREVYAL
LYSDKKDAPPLLPSDTGQGYRTVKAKLGSKKVRPWKWMPFTNPARKDGAMFFHWRRAAEE
GKDYPFARFNKTVQVPVYSEQEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRYDH
QQFKKRSVEDLKERYYHICAKLANVRAVPGTDLKIPVFDAGHERRRKEQLERLYNRTPEQ
VAEEEYLLQELRKIEARKKEREKRSQDLQKLITAADTTAEQRRTERKAPKKKLPQKKEAE
KPAVPETAGIKFPDFKSAGVTLRSQRMKLPSSVGQKKIKALEQMLLELGVELSPTPTEEL
VHMFNELRSDLVLLYELKQACANCEYELQMLRHRHEALARAGVLGGPATPASGPGPASAE
PAVTEPGLGPDPKDTIIDVVGAPLTPNSRKRRESASSSSSVKKAKKP

CDS  cDNA 1404 bp
   1 atggctacgg gcgcggatgt acgggacatt ctagaactcg ggggtccaga aggggatgca    60
  61 gcctctggga ccatcagcaa gaaggacatt atcaacccgg acaagaaaaa atccaagaag   120
 121 tcctctgaga cactgacttt caagaggccc gagggcatgc accgggaagt ctatgccttg   180
 181 ctctactctg acaagaagga tgcaccccca ctgctaccca gtgacactgg ccagggatac   240
 241 cgtacagtga aggccaagtt gggctccaag aaggtgcggc cttggaagtg gatgccattc   300
 301 accaacccgg cccgcaagga cggagcaatg ttcttccact ggcgacgtgc agcggaggag   360
 361 ggcaaggact acccctttgc caggttcaat aagactgtgc aggtgcctgt gtactcggag   420
 421 caggagtacc agctttatct ccacgatgat gcttggacta aggcagaaac tgaccacctc   480
 481 tttgacctca gccgccgctt tgacctgcgt tttgttgtta tccatgaccg gtatgaccac   540
 541 cagcagttca agaagcgttc tgtggaagac ctgaaggagc ggtactacca catctgtgct   600
 601 aagcttgcca acgtgcgggc tgtgccaggc acagacctta agataccagt atttgatgct   660
 661 gggcacgaac gacggcggaa ggaacagctt gagcgtctct acaaccggac cccagagcag   720
 721 gtggcagagg aggagtacct gctacaggag ctgcgcaaga ttgaggcccg gaagaaggag   780
 781 cgggagaaac gcagccagga cctgcagaag ctgatcacag cggcagacac cactgcagag   840
 841 cagcggcgca cggaacgcaa ggcccccaaa aagaagctac cccagaaaaa ggaggctgag   900
 901 aagccggctg ttcctgagac tgcaggcatc aagtttccag acttcaagtc tgcaggtgtc   960
 961 acgctgcgga gccaacggat gaagctgcca agctctgtgg gacagaagaa gatcaaggcc  1020
1021 ctggaacaga tgctgctgga gcttggtgtg gagctgagcc cgacacctac ggaggagctg  1080
1081 gtgcacatgt tcaatgagct gcgaagcgac ctggtgctgc tctacgagct caagcaggcc  1140
1141 tgtgccaact gcgagtatga gctgcagatg ctgcggcacc gtcatgaggc actggcccgg  1200
1201 gctggtgtgc tagggggccc tgccacacca gcatcaggcc caggcccggc ctctgctgag  1260
1261 ccggcagtga ctgaacccgg acttggtcct gaccccaagg acaccatcat tgatgtggtg  1320
1321 ggcgcacccc tcacgcccaa ttcgagaaag cgacgggagt cggcctccag ctcatcttcc  1380
1381 gtgaagaaag ccaagaagcc gtga  1404
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu