LOADING...
   BC006226;BC006226
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BC006226    RF.A4044B.DLX5            JCSG 430400 PDB Deposition 14-SEP-19

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONBC006226
DESCRIPTIONCASP Target
Description Hidden
ORGANISMHomo sapiens
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00046; Homeobox;
DR PDB; 4RDU; Identical; 19-NOV-14; HOMEOBOX PROTEIN DLX-5;
DR PDB; 2DJN; Identical; 05-OCT-06; HOMEOBOX PROTEIN DLX-5;
DR FFAS; 424681; Fold and function assignment.
DR TVPC; BC006226; Homologs in PDB, JCSG and SG center.
DR OVP; BC006226; Ortholog view popup.
DR TPM; BC006226; Target PDB monitor.
DR FSS; BC006226; Target function coverage.
PROPERTY Residues: 289 aa
Molecule Weight: 31538.23 Dalton
Isoelectric Point: 9.31
Extinction Coefficient: 44810
Gravy Index: -.78
Number of Met residues: 6
Percentage of Met residues: 2.08 %
Number of Cys residues: 2
Percentage of Cys residues: 0.69 %
SEQUENCE  amino acids 289 aa
>BC006226  BC006226 Homo sapiens distal-less homeobox 5, mRNA (cDNA clone MGC:10672 IMAGE:3941691), complete cd
MTGVFDRRVPSIRSGDFQAPFQTSAAMHHPSQESPTLPESSATDSDYYSPTGGAPHGYCS
PTSASYGKALNPYQYQYHGVNGSAGSYPAKAYADYSYASSYHQYGGAYNRVPSATNQPEK
EVTEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQ
VKIWFQNKRSKIKKIMKNGEMPPEHSPSSSDPMACNSPQSPAVWEPQGSSRSLSHHPHAH
PPTSNQSPASSYLENSASWYTSAASSINSHLPPPGSLQHPLALASGTLY

CDS  cDNA 870 bp
   1 atgacaggag tgtttgacag aagggtcccc agcatccgat ccggcgactt ccaagctccg    60
  61 ttccagacgt ccgcagctat gcaccatccg tctcaggaat cgccaacttt gcccgagtct   120
 121 tcagctaccg attctgacta ctacagccct acggggggag ccccgcacgg ctactgctct   180
 181 cctacctcgg cttcctatgg caaagctctc aacccctacc agtatcagta tcacggcgtg   240
 241 aacggctccg ccgggagcta cccagccaaa gcttatgccg actatagcta cgctagctcc   300
 301 taccaccagt acggcggcgc ctacaaccgc gtcccaagcg ccaccaacca gccagagaaa   360
 361 gaagtgaccg agcccgaggt gagaatggtg aatggcaaac caaagaaagt tcgtaaaccc   420
 421 aggactattt attccagctt tcagctggcc gcattacaga gaaggtttca gaagactcag   480
 481 tacctcgcct tgccggaacg cgccgagctg gccgcctcgc tgggattgac acaaacacag   540
 541 gtgaaaatct ggtttcagaa caaaagatcc aagatcaaga agatcatgaa aaacggggag   600
 601 atgcccccgg agcacagtcc cagctccagc gacccaatgg cgtgtaactc gccgcagtct   660
 661 ccagcggtgt gggagcccca gggctcgtcc cgctcgctca gccaccaccc tcatgcccac   720
 721 cctccgacct ccaaccagtc cccagcgtcc agctacctgg agaactctgc atcctggtac   780
 781 acaagtgcag ccagctcaat caattcccac ctgccgccgc cgggctcctt acagcacccg   840
 841 ctggcgctgg cctccgggac actctattag   870
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu