LOADING...
   BA20564A;BAIB
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
BA20564A    BA20564A            JCSG 420768 PDB Deposition 13-JUN-27              PDB id: 4lgc

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONBA20564A
DESCRIPTIONBile acid-coenzyme A ligase, ATP-dependent AMP-binding enzyme family, lipoprotein
ORGANISMClostridium scindens vpi 12708
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00501; AMP-binding;
DR PDB; 4LGC; Identical; 13-NOV-13; BILE ACID-COENZYME A LIGASE;
DR FFAS; 420768; Fold and function assignment.
DR TVPC; BA20564A; Homologs in PDB, JCSG and SG center.
DR OVP; BA20564A; Ortholog view popup.
DR TPM; BA20564A; Target PDB monitor.
DR FSS; BA20564A; Target function coverage.
PROPERTY Residues: 520 aa
Molecule Weight: 58291.06 Dalton
Isoelectric Point: 5.83
Extinction Coefficient: 70820
Gravy Index: -.21
Number of Met residues: 18
Percentage of Met residues: 3.46 %
Number of Cys residues: 15
Percentage of Cys residues: 2.88 %
SEQUENCE  amino acids 520 aa
>BA20564A  baiB
MHKKSACEREGKELKRDFFNKFNLGTSNFVTPGKQLEYVSECKPDSTAVICLDKEQNCSV
ITWHQLHVYSSQLAWYLIENEIGPGSIVLTMFPNSIEHIIAVFAIWKAGACYMPMSYKAA
ESEIREACDTIHPNAAFAECKIPGLKFCLSADEIYEAMEGRSKEMPSDRLANPNMISLSG
GTSGKMKFIRQNLPCGLDDETIRSWSLMSGMGFEQRQLLVGPLFHGAPHSAAFNGLFMGN
TLVLTRNLCPGNILNMIKKYKIEFIQMVPTLMNRLAKLEGVGKEDFASLKALCHTGGVCS
PWLKQIWIDLLGPEKIYEMYSMTECIGLTCIRGDEWVKHPGSIGRPVGDSKVSIRDENGK
EVAPFEIGEIYMTAPASYLVTEYINWEPLEVKEGGFRSVGDIGYVDEQGYLYFSDRRSDM
LVSGGENVFATEVETALLRYKDILDAVVVGIPDEDLGRRLHAVIETGKEIPAEELKTFLR
KYLTPYKIPKTFEFVRSIRRGDNGKADRKRILEDCIARGG

CDS  cDNA 1560 bp
   1 atgcacaaaa aatcagcgtg tgagagggag ggcaaggagt tgaagcgtga cttttttaac    60
  61 aagtttaatt tggggacatc gaactttgtc acgccgggaa aacagttgga atacgtttcg   120
 121 gaatgcaagc cagattctac tgcggtcatt tgcttagata aagaacagaa ctgttccgtt   180
 181 attacttggc atcagctgca cgtctattcc agccagctgg catggtacct tatagaaaat   240
 241 gagattggcc cggggtcgat cgtacttaca atgtttccga acagcatcga gcacattatt   300
 301 gcggtatttg caatctggaa ggcgggcgcc tgctatatgc ccatgtccta taaggcggcg   360
 361 gaatccgaga tcagggaggc ctgcgatacc atccacccga atgcggcttt tgcggaatgc   420
 421 aagattccag gattaaaatt ctgccttagc gcagacgaga tatatgaggc gatggaagga   480
 481 agatccaagg agatgccttc ggaccgtctg gccaatccga acatgatatc cttatcaggc   540
 541 ggaaccagcg gaaagatgaa gttcatccgt cagaaccttc catgcgggct ggacgatgag   600
 601 acgatcagaa gctggtcttt gatgtctgga atgggatttg agcagcgcca gctgctggta   660
 661 ggcccgctgt ttcatggcgc gcctcactcc gcggcgttta atggactgtt catgggcaac   720
 721 accctggtac tgaccaggaa cctttgcccg ggaaatatcc tgaacatgat taagaaatat   780
 781 aagattgaat ttatacagat ggtgccgacc ctgatgaacc ggcttgccaa actggaggga   840
 841 gtcggaaaag aagactttgc atccctgaag gcgctgtgcc atacaggggg cgtctgttct   900
 901 ccctggctta agcagatctg gatcgacctg ctggggcctg aaaagatcta tgagatgtat   960
 961 tccatgacgg aatgcatcgg ccttacctgc atccggggag acgagtgggt gaagcatccg  1020
1021 ggaagcatcg gacggccagt gggcgatagc aaggtgtcta tccgggatga gaatggcaag  1080
1081 gaagttgcgc cttttgagat tggcgagatc tatatgacag cgccggcctc ctatctggtt  1140
1141 accgagtaca tcaattggga accgctggaa gtgaaagagg gaggcttccg aagcgtaggg  1200
1201 gatatcggct acgtggatga gcagggctat ctgtactttt ctgaccggcg cagcgacatg  1260
1261 ctggtatcag gcggagaaaa cgtgttcgcc accgaagtcg agacggcgct tttgagatat  1320
1321 aaggatatcc tggacgctgt agtggtaggg ataccggatg aagatctggg gcgaaggctc  1380
1381 catgcggtca ttgagacagg gaaagagata ccggcagagg aactgaaaac attcctgaga  1440
1441 aagtatctga ctccatataa gataccaaag acgttcgagt tcgtaaggag catacgaagg  1500
1501 ggagacaatg gaaaggccga caggaagcgg atcctggaag attgtattgc ccgcggggga  1560
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu