LOADING...
   AF124247;AF124247
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
AF124247    RC2754B.LRH_1            JCSG 430676 PDB Deposition 14-DEC-05

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSIONAF124247
DESCRIPTIONAF124247 Homo sapiens hepatocytic transcription factor hB1F-2 (B1F2) mRNA, compl
ete cds, coding region:1-1623
ORGANISMHOMO SAPIENS
COMMENT 
DR UNIPROT;
DR SPTR;
DR GenBank;
DR Pfam; PF00104; Hormone_recep;
DR Pfam; PF00105; zf-C4;
DR PDB; 4ONI; Identical; 11-FEB-15; NUCLEAR RECEPTOR SUBFAMILY 5 GROUP A MEMBER 2;
DR PDB; 4RWV; Identical; 21-JAN-15; NUCLEAR RECEPTOR SUBFAMILY 5 GROUP A MEMBER 2;
DR PDB; 1ZDU; Identical; 24-MAY-05; ORPHAN NUCLEAR RECEPTOR NR5A2;
DR PDB; 3TX7; Identical; 14-DEC-11; CATENIN BETA-1;
DR PDB; 1YUC; Identical; 01-MAR-05; ORPHAN NUCLEAR RECEPTOR NR5A2;
DR PDB; 4DOR; Identical; 18-APR-12; NUCLEAR RECEPTOR SUBFAMILY 5 GROUP A MEMBER 2;
DR PDB; 4DOS; Identical; 18-APR-12; NUCLEAR RECEPTOR SUBFAMILY 5 GROUP A MEMBER 2;
DR PDB; 1YOK; Identical; 19-JUL-05; ORPHAN NUCLEAR RECEPTOR NR5A2;
DR FFAS; 423218; Fold and function assignment.
DR TVPC; AF124247; Homologs in PDB, JCSG and SG center.
DR OVP; AF124247; Ortholog view popup.
DR TPM; AF124247; Target PDB monitor.
DR FSS; AF124247; Target function coverage.
PROPERTY Residues: 541 aa
Molecule Weight: 61328.25 Dalton
Isoelectric Point: 8.08
Extinction Coefficient: 46760
Gravy Index: -.4
Number of Met residues: 22
Percentage of Met residues: 4.07 %
Number of Cys residues: 14
Percentage of Cys residues: 2.59 %
SEQUENCE  amino acids 541 aa
>AF124247  AF124247 Homo sapiens hepatocytic transcription factor hB1F-2 (B1F2) mRNA, complete cds, coding regi
MSSNSDTGDLQESLKHGLTPIGAGLPDRHGSPIPARGRLVMLPKVETEALGLARSHGEQG
QMPENMQVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRY
TCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQ
QKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPF
VTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPAS
IPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWA
RSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQA
GATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAA
LLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKR
A

CDS  cDNA 1626 bp
   1 atgtcttcta attcagatac tggggattta caagagtctt taaagcacgg acttacacct    60
  61 attggtgctg ggcttccgga ccgacacgga tcccccatcc ccgcccgcgg tcgccttgtc   120
 121 atgctgccca aagtggagac ggaagccctg ggactggctc gatcgcatgg ggaacagggc   180
 181 cagatgccgg aaaacatgca agtgtctcaa tttaaaatgg tgaattactc ctatgatgaa   240
 241 gatctggaag agctttgtcc cgtgtgtgga gataaagtgt ctgggtacca ttatgggctc   300
 301 ctcacctgtg aaagctgcaa gggatttttt aagcgaacag tccaaaataa taaaaggtac   360
 361 acatgtatag aaaaccagaa ctgccaaatt gacaaaacac agagaaagcg ttgtccttac   420
 421 tgtcgttttc aaaaatgtct aagtgttgga atgaagctag aagctgtaag ggccgaccga   480
 481 atgcgtggag gaaggaataa gtttgggcca atgtacaaga gagacagggc cctgaagcaa   540
 541 cagaaaaaag ccctcatccg agccaatgga cttaagctag aagccatgtc tcaggtgatc   600
 601 caagctatgc cctctgacct gaccatttcc tctgcaattc aaaacatcca ctctgcctcc   660
 661 aaaggcctac ctctgaacca tgctgccttg cctcctacag actatgacag aagtcccttt   720
 721 gtaacatccc ccattagcat gacaatgccc cctcacggca gcctgcaagg ttaccaaaca   780
 781 tatggccact ttcctagccg ggccatcaag tctgagtacc cagaccccta taccagctca   840
 841 cccgagtcca taatgggcta ttcatatatg gatagttacc agacgagctc tccagcaagc   900
 901 atcccacatc tgatactgga acttttgaag tgtgagccag atgagcctca agtccaggct   960
 961 aaaatcatgg cctatttgca gcaagagcag gctaaccgaa gcaagcacga aaagctgagc  1020
1021 acctttgggc ttatgtgcaa aatggcagat caaactctct tctccattgt cgagtgggcc  1080
1081 aggagtagta tcttcttcag agaacttaag gttgatgacc aaatgaagct gcttcagaac  1140
1141 tgctggagtg agctcttaat cctcgaccac atttaccgac aagtggtaca tggaaaggaa  1200
1201 ggatccatct tcctggttac tgggcaacaa gtggactatt ccataatagc atcacaagcc  1260
1261 ggagccaccc tcaacaacct catgagtcat gcacaggagt tagtggcaaa acttcgttct  1320
1321 ctccagtttg atcaacgaga gttcgtatgt ctgaaattct tggtgctctt tagtttagat  1380
1381 gtcaaaaacc ttgaaaactt ccagctggta gaaggtgtcc aggaacaagt caatgccgcc  1440
1441 ctgctggact acacaatgtg taactacccg cagcagacag agaaatttgg acagctactt  1500
1501 cttcgactac ccgaaatccg ggccatcagt atgcaggctg aagaatacct ctactacaag  1560
1561 cacctgaacg gggatgtgcc ctataataac cttctcattg aaatgttgca tgccaaaaga  1620
1621 gcataa  1626
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu