LOADING...
   2635576;2635576
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
2635576    CL5902A            JCSG 362376 PDB Deposition 07-JUN-08              PDB id: 2q83

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSION2635576
DESCRIPTIONytaA
ORGANISMBacillus subtilis
COMMENT 
DR UNIPROT; O34656_BACSU
DR SPTR; O34656 (flat text); O34656 (good view)
DR GenBank; CAB15070
DR Pfam; PF01636; APH;
DR PDB; 2Q83; Identical; 26-JUN-07; YTAA PROTEIN;
DR FFAS; 359091; Fold and function assignment.
DR TVPC; 2635576; Homologs in PDB, JCSG and SG center.
DR OVP; 2635576; Ortholog view popup.
DR TPM; 2635576; Target PDB monitor.
DR FSS; 2635576; Target function coverage.
PROPERTY Residues: 357 aa
Molecule Weight: 41243.26 Dalton
Isoelectric Point: 5.16
Extinction Coefficient: 63370
Gravy Index: -.39
Number of Met residues: 11
Percentage of Met residues: 3.08 %
Number of Cys residues: 4
Percentage of Cys residues: 1.12 %
SEQUENCE  amino acids 357 aa
>2635576  gi|2635576|emb|CAB15070.1| similar to spore coat protein [Bacillus subtilis]
MCPLMAENHEVIEEGNSSELPLSAEDAKKLTELAENVLQGWDVQAEKIDVIQGNQMALVW
KVHTDSGAVCLKRIHRPEKKALFSIFAQDYLAKKGMNVPGILPNKKGSLYSKHGSFLFVV
YDWIEGRPFELTVKQDLEFIMKGLADFHTASVGYQPPNGVPIFTKLGRWPNHYTKRCKQM
ETWKLMAEAEKEDPFSQLYLQEIDGFIEDGLRIKDRLLQSTYVPWTEQLKKSPNLCHQDY
GTGNTLLGENEQIWVIDLDTVSFDLPIRDLRKMIIPLLDTTGVWDDETFNVMLNAYESRA
PLTEEQKQVMFIDMLFPYELYDVIREKYVRKSALPKEELESAFEYERIKANALRQLI

CDS  cDNA 1074 bp
   1 atgtgtcctt taatggcaga aaaccatgaa gtcattgagg aggggaattc atcagagctt    60
  61 cctttatcag cagaagatgc aaaaaaatta acggagctgg ctgaaaatgt gcttcaagga   120
 121 tgggatgtgc aggctgaaaa aatagacgtc attcagggaa accagatggc gcttgtctgg   180
 181 aaggtccaca cagactccgg cgcggtttgt ctaaaacgaa tacacaggcc agaaaagaaa   240
 241 gcgttgtttt ccattttcgc gcaggactat ttagcaaaaa aaggcatgaa tgttcctggc   300
 301 atactcccaa acaaaaaagg cagcctatat tctaagcacg gctcatttct atttgtcgta   360
 361 tatgactgga tcgaaggaag accgtttgag ctgactgtaa agcaggactt ggagtttatc   420
 421 atgaaaggcc ttgctgattt tcatacagct tccgtcggat atcagccgcc aaatggcgtt   480
 481 cccatattta ccaaattagg tcgctggccg aatcactaca cgaaacgatg caaacagatg   540
 541 gaaacgtgga agctgatggc ggaggcggaa aaagaagatc ctttctcaca gctttatctt   600
 601 caggagatag atggctttat tgaagacggg ctgcgcatca aagaccggct tttgcaatcg   660
 661 acctatgttc catggactga acagctgaaa aaaagcccta acctttgcca ccaggattac   720
 721 ggaaccggga atacactctt aggagaaaat gaacagattt gggtcatcga cttagatacc   780
 781 gtatcatttg atctgcctat tcgcgatttg cgcaaaatga ttattccgct tttggatacg   840
 841 acgggtgttt gggatgacga aacatttaat gtcatgctga acgcatacga atccagagcc   900
 901 ccattaactg aagaacaaaa acaagtcatg tttattgata tgctgtttcc ttacgagctt   960
 961 tacgatgtca ttcgcgaaaa atacgtccgc aagtctgctt taccgaagga agaattagaa  1020
1021 tcagcttttg aatatgaacg cattaaagca aacgcattgc ggcagcttat ttaa  1074
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
3161131 3162204 1 Glimmer3 score - -
Genemark probabilities .84   .38 poor
GenemarkHMM class - -

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu