LOADING...
   13422365;PC07372D
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
13422365    PC07372D            JCSG 361201 PDB Deposition 16-AUG-26              PDB id: 4goq, 2n6e

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSION13422365
DESCRIPTIONDUF1491 family protein (CC_1065)
ORGANISMCaulobacter crescentus
COMMENT 
DR UNIPROT; Q9A9C4_CAUCR
DR SPTR; Q9A9C4 (flat text); Q9A9C4 (good view)
DR GenBank; AAK23049
DR Pfam; PF07372; DUF1491;
DR PDB; 4GOQ; Identical; 19-SEP-12; HYPOTHETICAL PROTEIN;
DR PDB; 2N6E; Identical; 14-OCT-15; UNCHARACTERIZED PROTEIN;
DR PDB; 2KNR; Highly similar; 03-NOV-09; UNCHARACTERIZED PROTEIN ATC0905;
DR FFAS; 361201; Fold and function assignment.
DR TVPC; 13422365; Homologs in PDB, JCSG and SG center.
DR OVP; 13422365; Ortholog view popup.
DR TPM; 13422365; Target PDB monitor.
DR FSS; 13422365; Target function coverage.
PROPERTY Residues: 109 aa
Molecule Weight: 12188.04 Dalton
Isoelectric Point: 5.02
Extinction Coefficient: 17990
Gravy Index: -.31
Number of Met residues: 2
Percentage of Met residues: 1.83 %
Number of Cys residues: 0
Percentage of Cys residues: 0.00 %
SEQUENCE  amino acids 109 aa
>13422365  gi|13422365|gb|AAK23049.1| hypothetical protein [Caulobacter crescentus]
MLLSTDIWVAALIRRAELGGAFATVARKGDARAGAVLVKAVDRREGTARLFSEATRGDGE
RFWMQPVRSTFEPDLDAYAERAARIDPDIWVVEIEDRDGRHFLTEPVES

CDS  cDNA 330 bp
   1 atgcttcttt cgacggatat ctgggtcgcg gcgctgatcc gccgggccga actgggcggg    60
  61 gccttcgcta cggtcgctcg caagggtgac gcgcgcgccg gcgcggttct ggtcaaggcg   120
 121 gtcgatcgcc gggaggggac cgcgcgcctg ttcagcgagg cgacgcgcgg agacggcgag   180
 181 cgcttttgga tgcagcctgt gcgctcgacc ttcgagccgg atctggacgc ctacgccgag   240
 241 cgcgccgcgc gtatcgaccc ggatatctgg gtggtcgaga tcgaggatcg cgacggtcgc   300
 301 cattttctga ccgagccggt tgagtcctga   330
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
1197287 1197616 2 Glimmer3 score 12.69 good
Genemark probabilities .71   .46 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu