LOADING...
   10640715;10640715
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
10640715    CL6252A            JCSG 359680 PDB Deposition 06-JAN-27              PDB id: 2fur

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSION10640715
DESCRIPTIONPutative FMN-binding protein
ORGANISMThermoplasma acidophilum
COMMENT 
DR UNIPROT; Q9HIG7_THEAC
DR SPTR; Q9HIG7 (flat text); Q9HIG7 (good view)
DR GenBank; CAC12493
DR PDB; 2FUR; Identical; 28-FEB-06; HYPOTHETICAL PROTEIN;
DR FFAS; 359680; Fold and function assignment.
DR TVPC; 10640715; Homologs in PDB, JCSG and SG center.
DR OVP; 10640715; Ortholog view popup.
DR TPM; 10640715; Target PDB monitor.
DR FSS; 10640715; Target function coverage.
PROPERTY Residues: 208 aa
Molecule Weight: 23334.65 Dalton
Isoelectric Point: 6.33
Extinction Coefficient: 20400
Gravy Index: -.15
Number of Met residues: 6
Percentage of Met residues: 2.88 %
Number of Cys residues: 2
Percentage of Cys residues: 0.96 %
SEQUENCE  amino acids 208 aa
>10640715  gi|10640715|emb|CAC12493.1| hypothetical protein [Thermoplasma acidophilum]
MAVECIKDKVTRYPERASYSDEDLVAMLDRNFTCTVSFIDGGIPYAIPMMLASEGKTIYL
HGSMKSRIYGILKTGQLIAISLLEINGIVLAKEIKNNSINYVSALIFGRPYEIDDTEKKI
EVFRLLTEKLVKGRRDNSIKPSYEDLNGVFVFAVKPETFSMKARTGPPHDTSTDDIWSGV
LPIQHTISEAGENAPEYVKSLYGKRIFI

CDS  cDNA 627 bp
   1 atggctgtcg agtgtataaa agataaggtt accagatatc cagaaagggc ctcatacagc    60
  61 gatgaggatc ttgtggcaat gctagaccga aatttcacat gcacggtttc cttcatcgat   120
 121 gggggcatcc cttatgccat acccatgatg ctggccagcg aaggcaaaac catatacctt   180
 181 catggatcca tgaagagcag gatatacggc atactgaaaa ccggccaact gattgcgatc   240
 241 tcgctcctgg agataaatgg catagtgctt gcaaaagaaa tcaaaaacaa ttcgataaac   300
 301 tatgtttccg cgctcatctt cggcaggcca tatgagatcg atgacactga aaagaagatc   360
 361 gaggttttcc ggttgctgac cgaaaaattg gtgaagggca ggcgggacaa ttccataaag   420
 421 ccttcttatg aggacctgaa tggtgtcttt gtctttgcgg tcaagcctga aacgttttcg   480
 481 atgaaagcaa gaaccgggcc gcctcacgat acatcgactg atgatatctg gtctggagtg   540
 541 ctgcccatac agcatacaat aagcgaagca ggagaaaatg caccggaata tgtgaaatct   600
 601 ctttatggca agaggatctt catctga   627
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu