LOADING...
   10640422;PC02663D
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
10640422    PC02663D            JCSG 361192 PDB Deposition 06-MAY-02              PDB id: 2gvi

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSION10640422
DESCRIPTIONPutative subunit E of formylmethanofuran dehydrogenase (FmdE/GAPDH domain-like fold)
ORGANISMThermoplasma acidophilum
COMMENT 
DR UNIPROT; Q9HJ63_THEAC
DR SPTR; Q9HJ63 (flat text); Q9HJ63 (good view)
DR GenBank; CAC12236
DR Pfam; PF02663; FmdE;
DR PDB; 2GVI; Identical; 13-JUN-06; CONSERVED HYPOTHETICAL PROTEIN;
DR KEGG; 1.; Enzyme page
DR FFAS; 361192; Fold and function assignment.
DR TVPC; 10640422; Homologs in PDB, JCSG and SG center.
DR OVP; 10640422; Ortholog view popup.
DR TPM; 10640422; Target PDB monitor.
DR FSS; 10640422; Target function coverage.
PROPERTY Residues: 203 aa
Molecule Weight: 23080.09 Dalton
Isoelectric Point: 6.13
Extinction Coefficient: 31860
Gravy Index: -.53
Number of Met residues: 6
Percentage of Met residues: 2.96 %
Number of Cys residues: 6
Percentage of Cys residues: 2.96 %
SEQUENCE  amino acids 203 aa
>10640422  gi|10640422|emb|CAC12236.1| conserved hypothetical protein [Thermoplasma acidophilum]
MEKLNFGIPEWAFEFHGHKCPYMPMGYRAGSYALKIAGLEKEKDHRTYLLSEMSPEDMNG
CFNDGAQAATGCTYGKGLFSLLGYGKLALILYRPGRKAIRVHVRNSFMDELSTRASDFFR
YRKQGYEPSEIPAGAIDPVLEWISSLEDEEIFEYREIDGFTFEPVKKNGAKVRCDVCGEY
TYEADAKLLNGKPVCKPDYYGKK

CDS  cDNA 612 bp
   1 atggagaaac tgaatttcgg aattccagag tgggctttcg agtttcatgg gcacaagtgt    60
  61 ccgtacatgc ccatgggcta cagggccggt tcctatgctc tgaagatcgc aggcctggaa   120
 121 aaggagaagg atcacagaac ctaccttctt tctgagatgt cccctgagga tatgaatggc   180
 181 tgcttcaatg acggtgcaca ggctgcaacc ggatgcacct atggaaaggg cctgttctca   240
 241 ttgctgggat acggaaaatt ggcattgata ctttacaggc caggaaggaa agcgatccgc   300
 301 gtgcatgtac gcaacagttt catggatgaa ctcagcacca gggcttcaga tttcttcaga   360
 361 tacaggaaac agggatacga accatcggag ataccggcag gcgcaataga tcctgtgctt   420
 421 gaatggatct catcgctcga ggatgaggag atattcgaat accgggagat tgacggtttc   480
 481 acctttgaac ccgtgaagaa aaacggtgcg aaggtcaggt gcgatgtctg cggagaatac   540
 541 acatacgaag cggatgccaa gttgctgaac ggaaagcctg tgtgcaagcc tgattactac   600
 601 ggcaagaaat ga   612
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu