LOADING...
   10640157;10640157
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
10640157    XB5612A            JCSG 381882 PDB Deposition 07-NOV-20              PDB id: 3bf5

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSION10640157
DESCRIPTIONPutative ribokinase.
ORGANISMThermoplasma acidophilum
COMMENT 
DR UNIPROT; Q9HJT3_THEAC
DR SPTR; Q9HJT3 (flat text); Q9HJT3 (good view)
DR GenBank; CAC12009
DR Pfam; PF00294; PfkB;
DR PDB; 3BF5; Identical; 04-DEC-07; RIBOKINASE RELATED PROTEIN;
DR FFAS; 358750; Fold and function assignment.
DR TVPC; 10640157; Homologs in PDB, JCSG and SG center.
DR OVP; 10640157; Ortholog view popup.
DR TPM; 10640157; Target PDB monitor.
DR FSS; 10640157; Target function coverage.
PROPERTY Residues: 287 aa
Molecule Weight: 32803.58 Dalton
Isoelectric Point: 6.38
Extinction Coefficient: 27850
Gravy Index: -.43
Number of Met residues: 13
Percentage of Met residues: 4.53 %
Number of Cys residues: 1
Percentage of Cys residues: 0.35 %
SEQUENCE  amino acids 287 aa
>10640157  gi|10640157|emb|CAC12009.1| ribokinase related protein [Thermoplasma acidophilum]
MRFLAYFGHLNIDVLISVDSIPREGSVNVKDLRPRFGGTAGNFAIVAQKFRIPFDLYSAV
GMKTHREYLAMIESMGINTGHVEKFEDESGPICYIATDGKKQVSFMHQGAMEKWKPQLAD
EYEYVHFSTGPNYLDMAKSIRSKIIFDPSQEIHKYSKDELKKFHEISYMSIFNDHEYRVF
REMTGLSSPKVTTIVTNGERGSSLFMDGKKYDFPAIPSSGDTVGAGDSFRAGLYLALYNR
RSIEKGMIYGTIIAHHVIDDGIENFSLNMEDLERETENYRRMFTKRS

CDS  cDNA 864 bp
   1 atgaggtttc tcgcctactt tggacatctc aacatagacg ttctcatatc ggtagattca    60
  61 attccgcgtg aaggatctgt taatgttaag gatctcaggc cacgcttcgg cggtaccgct   120
 121 ggaaactttg ccattgttgc acagaagttc cggattccat tcgacttgta ctcggctgtg   180
 181 ggaatgaaga cgcacaggga atacctggcc atgatcgaga gcatgggcat aaatacgggc   240
 241 cacgtggaga agttcgaaga tgagagcggc ccgatatgct atattgccac tgacggaaag   300
 301 aagcaggtct cctttatgca tcaaggggca atggaaaaat ggaaaccgca gttagcggat   360
 361 gaatacgagt atgttcattt cagcaccgga cccaattatc tggatatggc caagagcatc   420
 421 agatcgaaaa taatattcga tccttcgcag gagatacaca aatattccaa agacgaacta   480
 481 aagaaattcc atgaaatttc gtacatgtcc atattcaacg atcacgagta ccgcgtattc   540
 541 agagaaatga ctggcctgag ctctccaaag gttacgacga tcgtaaccaa tggagaaaga   600
 601 ggatcttcac tgttcatgga tgggaaaaaa tatgattttc ctgccatccc atccagtggt   660
 661 gatacggttg gtgccgggga ctccttccga gcaggccttt atctggccct ctacaaccgc   720
 721 aggagcatag aaaagggcat gatctacggc acaataatag cacaccacgt tatagatgat   780
 781 ggaatcgaaa acttttcgct caatatggaa gatctggaaa gagaaaccga gaattacaga   840
 841 cgcatgttca caaagagatc ctga   864
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu