LOADING...
   104161995;ME9797A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
104161995    ME9797A            JCSG 371986 PDB Deposition 07-MAY-01              PDB id: 2pq7

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSION104161995
DESCRIPTIONpredicted HD superfamily hydrolase
ORGANISMUncultured thermotogales bacterium
COMMENT 
DR UNIPROT; Q1EM40_9BACT
DR SPTR;
DR GenBank; CAJ75704
DR Pfam; PF01966; HD;
DR PDB; 2PQ7; Identical; 15-MAY-07; PREDICTED HD SUPERFAMILY HYDROLASE;
DR PDB; 3DTO; Highly similar; 09-SEP-08; BH2835 PROTEIN;
DR PDB; 2QGS; Highly similar; 17-JUL-07; PROTEIN SE1688;
DR PDB; 3DJB; Highly similar; 19-AUG-08; HYDROLASE, HD FAMILY;
DR PDB; 3GW7; Highly similar; 14-APR-09; UNCHARACTERIZED PROTEIN YEDJ;
DR PDB; 2PJQ; Highly similar; 01-MAY-07; UNCHARACTERIZED PROTEIN LP_2664;
DR FFAS; 371986; Fold and function assignment.
DR TVPC; 104161995; Homologs in PDB, JCSG and SG center.
DR OVP; 104161995; Ortholog view popup.
DR TPM; 104161995; Target PDB monitor.
DR FSS; 104161995; Target function coverage.
PROPERTY Residues: 219 aa
Molecule Weight: 24633.54 Dalton
Isoelectric Point: 6.36
Extinction Coefficient: 19940
Gravy Index: -.29
Number of Met residues: 5
Percentage of Met residues: 2.28 %
Number of Cys residues: 1
Percentage of Cys residues: 0.46 %
SEQUENCE  amino acids 219 aa
>104161995  gi|104161995|emb|CAJ75704.1| predicted HD superfamily hydrolase [uncultured Thermotogales bacterium]
MNLTELMERIPHLREILNIVREAFKDYDDPAHDISHTFRVMENASEIASREKCDLQKAII
AALLHDIKRPHEALTGVDHAESGAEYASGLLPTMGFDISFVAEVSKAIRSHRYSGGLTPT
SLTGKILQDADRLDAIGAVAIARVFSYSGKTGTPLHSLQFSPRSSYSGNSRSSINHFHEK
ILKIRPETFWTETARKMAEDRYSFVVEFVQRFLAEWGQI

CDS  cDNA 657 bp
   1 atgaatctta cagagcttat ggaacgcatt ccacatttga gagaaatcct caacatcgtt    60
  61 agggaagcct tcaaagacta tgatgaccct gctcatgata tttcgcacac tttcagggta   120
 121 atggagaatg cgagcgaaat agcttctcgg gagaagtgtg accttcaaaa ggcgataata   180
 181 gccgcactac ttcatgacat aaagaggcct cacgaagctc ttaccggagt cgatcatgct   240
 241 gaatccggtg cggaatatgc ttcaggactt ctaccgacaa tgggttttga catttcgttt   300
 301 gtcgcggaag tctcaaaggc tattaggtct cacagatact ccggtggctt aacacctacc   360
 361 agtctgacgg gaaagatcct ccaggatgca gacagactag acgcaatagg tgcggtagcg   420
 421 atagcaagag tcttttccta ttccggaaag accggaactc ctcttcactc tctccaattc   480
 481 agtccgcgca gctcttatag cggcaattcg cgtagttcta taaatcactt tcacgagaag   540
 541 atacttaaga taagaccgga gactttctgg acggaaactg caagaaaaat ggctgaggac   600
 601 cgctacagtt tcgttgtgga atttgtgcag aggttcctag ccgaatgggg acaaatc   657
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu