LOADING...
   10174951;10174951
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
10174951    10174951            JCSG 356107 PDB Deposition 04-JUL-09              PDB id: 1vl5

Protein Sequence Information


TOPSAN
JCSG Internal annotations

ACCESSION10174951
DESCRIPTIONPutative methyltransferase
ORGANISMBacillus halodurans
COMMENT 
DR UNIPROT; Q9KAF6_BACHD
DR SPTR; Q9KAF6 (flat text); Q9KAF6 (good view)
DR GenBank; BAB06050
DR Pfam; PF08241; Methyltransf_11;
DR Pfam; PF08242; Methyltransf_12;
DR Interpro; IPR001601; Methyltransf;
DR Interpro; IPR000051; SAM_bind;
DR Interpro; IPR004033; UbiE/COQ5mtfrase;
DR PDB; 1VL5; Identical; 17-AUG-04; UNKNOWN CONSERVED PROTEIN BH2331;
DR PDB; 1XXL; Highly similar; 23-NOV-04; YCGJ PROTEIN;
DR PDB; 2GLU; Highly similar; 18-APR-06; YCGJ;
DR FFAS; 356107; Fold and function assignment.
DR TVPC; 10174951; Homologs in PDB, JCSG and SG center.
DR OVP; 10174951; Ortholog view popup.
DR TPM; 10174951; Target PDB monitor.
DR FSS; 10174951; Target function coverage.
PROPERTY Residues: 265 aa
Molecule Weight: 30361.91 Dalton
Isoelectric Point: 6.42
Extinction Coefficient: 29910
Gravy Index: -.52
Number of Met residues: 5
Percentage of Met residues: 1.89 %
Number of Cys residues: 3
Percentage of Cys residues: 1.13 %
SEQUENCE  amino acids 265 aa
>10174951  gi|10174951|dbj|BAB06050.1| BH2331~unknown conserved protein [Bacillus halodurans]
MEEHKAKVQSQFSKSAERYVTSQIHAKGSDLAKLMQIAALKGNEEVLDVATGGGHVANAF
APFVKKVVAFDLTEDILKVARAFIEGNGHQQVEYVQGDAEQLPFTDERFHIVTCRIAAHH
FPNPASFVSEAYRVLKKGGQLLLVDNSAPENDAFDVFYNYVEKERDYSHHRAWKKSDWLK
MLEEAGFELEELHCFHKTFIFEDWCDRMNVTTEKKQELSDFIKSKPTEYYQKFKIVVEDG
RVYSFRGESILMKARKPTVKNKGSS

CDS  cDNA 798 bp
   1 gtggaggagc ataaagccaa agtgcaatca caattcagca aaagcgcgga acgttacgtg    60
  61 acaagtcaga tccatgcgaa aggaagcgac ttggccaagc ttatgcaaat cgcagcgcta   120
 121 aaagggaacg aggaggttct cgatgtggca actggcggcg ggcatgtggc caatgcgttc   180
 181 gctccgtttg taaaaaaggt cgttgcgttc gatttaacgg aagatatttt aaaagtagcg   240
 241 cgagcattta ttgaggggaa cggtcaccaa caggtggagt acgtacaagg tgatgccgaa   300
 301 caattgcctt ttactgatga acgatttcat atcgttacat gtcgaattgc ggctcatcat   360
 361 tttcccaatc ctgcatcttt tgttagcgaa gcctatcgcg tgttaaaaaa agggggacag   420
 421 ttgttattgg ttgataacag cgctccagaa aacgatgcct ttgatgtttt ctacaattat   480
 481 gtagaaaaag agcgagatta tagccatcat cgcgcctgga aaaagtcaga ttggttgaaa   540
 541 atgcttgaag aagccggatt tgaactcgaa gaactccact gttttcataa aacgttcatc   600
 601 tttgaagact ggtgtgaccg gatgaacgtt acaacagaaa agaaacagga gctttccgac   660
 661 tttatcaaaa gcaagccaac cgaatattat caaaagttca aaattgtcgt ggaggatggg   720
 721 agagtgtact cctttagagg tgaatcgatt ttaatgaagg cgagaaagcc aacggtaaaa   780
 781 aataaaggtt catcatag   798
Warning: the change of start codon from ATG/M to GTG/V;
Target constructs
Download sequence in PIR or FASTA format
Chemical properties of sequence with tag
GENE PREDICTION
LEFT END RIGHT END FRAME PREDICTOR SCORE 
2453426 2454223 -2 Glimmer3 score 7.69 poor
Genemark probabilities .75   .19 poor
GenemarkHMM class 1 good

Notes

The start codon is a ATG/Methionine in most of sequences, but the GTG/V, TTG/L, CTG/I can be the start codons in some cases as expressing in E.coli. The start codon warning is labelled by RED color in sequence(sample: 10174951).

Protein sequence information contains the annotation contents from both of JCSG and SWISS-PROT. The SWISS-PROT/TrEMBL annotation is accessed from SWALL(SPTR) on the EBI SRS server. PDB homologes show both identical and highly similar proteins with released date and protein function.


Contact Webmaster JCSG Menu