LOADING...
   ZP_03779557.1;BAIE
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_03779557.1 Chemical properties of protein sequence with tag

Accession: ZP_03779557.1
Description: gi|225570532|ref|ZP_03779557.1| hypothetical protein CLOHYLEM_06634 [Clostridium hylemonae DSM 15053]
Organism: Clostridium hylemonae DSM 15053
  No Tag Tag
Residues(aa) 169 181
Molecular Weight (Dalton) 19871.75 21326.30
Isoelectric Point 5.8 6.26
Extinction Coefficient 31400 31400
Gravy -.74 -0.81
Number of Met 8 9
%Met 4.73 4.97
Number of Cys 1 1
%Cys 0.59 0.55
SEQUENCE  amino acids 181 aa; containing Tag mgsdkihhhhhh
>ZP_03779557.1 gi|225570532|ref|ZP_03779557.1| hypothetical protein CLOHYLEM_06634 [Clostridium hylemonae DSM 15053]
mgsdkihhhhhhMSIEERLEALEKEIQKMKDIEEIKKLKGQYFRCLDGKFWDELETTLSP
NIVTSYSNGKLVFHGPKEVTDYFKKAMPREEISMHMGHTPEITIDSETTATGRWYLEDKL
IFTEESKYAGSGVNGGAFYTDKYEKVDGKWYILETGYLRVYEEHFMRDPKIKITMNMHKT
K

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu