LOADING...
   ZP_03458806.1;SP13538B
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_03458806.1 Chemical properties of protein sequence with tag

Accession: ZP_03458806.1
Description: gi|218130002|ref|ZP_03458806.1| hypothetical protein BACEGG_01585 [Bacteroides eggerthii DSM 20697]
Organism: Bacteroides eggerthii DSM 20697
  No Tag Tag
Residues(aa) 150 162
Molecular Weight (Dalton) 17245.67 18700.22
Isoelectric Point 6.58 7.05
Extinction Coefficient 39880 39880
Gravy -.55 -0.64
Number of Met 5 6
%Met 3.33 3.70
Number of Cys 3 3
%Cys 2.00 1.85
SEQUENCE  amino acids 162 aa; containing Tag mgsdkihhhhhh
>ZP_03458806.1 gi|218130002|ref|ZP_03458806.1| hypothetical protein BACEGG_01585 [Bacteroides eggerthii DSM 20697]
mgsdkihhhhhhMKKLLNGTILLLLMCAVSGLTSCMNDGGSDWVGKWQLREYQYPDGKVQ
KVDSIFYGFQKGSFLAYCMNKSGSYEGFYGYYKLKDDEISITLWPDNSSGNEAAHEELVN
SASYKNFFGWGDTGERTFKVEELTDKKMRLNYEGTKYVFRKY

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu