LOADING...
   ZP_02072838.1;SP13297C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02072838.1 Chemical properties of protein sequence with tag

Accession: ZP_02072838.1
Description: gi|160891835|ref|ZP_02072838.1| hypothetical protein BACUNI_04292 [Bacteroides uniformis ATCC 8492]
Organism: Bacteroides uniformis
  No Tag Tag
Residues(aa) 130 142
Molecular Weight (Dalton) 14704.22 16158.77
Isoelectric Point 9.63 9.59
Extinction Coefficient 8480 8480
Gravy -.25 -0.38
Number of Met 3 4
%Met 2.31 2.82
Number of Cys 1 1
%Cys 0.77 0.70
SEQUENCE  amino acids 142 aa; containing Tag mgsdkihhhhhh
>ZP_02072838.1 gi|160891835|ref|ZP_02072838.1| hypothetical protein BACUNI_04292 [Bacteroides uniformis ATCC 8492]
mgsdkihhhhhhMKKRVIFLLTGLFIWTSVLLAQNVPEGVIGAFKEGNSQELNKYLGDKV
DLIIQNKSTHADKRTAEGTMAAFFSNHKVGSFNVNHQGKRDESGFVIGILMTANGNFRVN
CFFRKVQNKYVIHQIRIDKTDE

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu