LOADING...
   ZP_02069929.1;SP13538A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02069929.1 Chemical properties of protein sequence with tag

Accession: ZP_02069929.1
Description: gi|160888926|ref|ZP_02069929.1| hypothetical protein BACUNI_01346 [Bacteroides uniformis ATCC 8492]
Organism: Bacteroides uniformis
  No Tag Tag
Residues(aa) 135 147
Molecular Weight (Dalton) 15324.81 16779.36
Isoelectric Point 7.59 7.70
Extinction Coefficient 29910 29910
Gravy -.12 -0.26
Number of Met 3 4
%Met 2.22 2.72
Number of Cys 4 4
%Cys 2.96 2.72
SEQUENCE  amino acids 147 aa; containing Tag mgsdkihhhhhh
>ZP_02069929.1 gi|160888926|ref|ZP_02069929.1| hypothetical protein BACUNI_01346 [Bacteroides uniformis ATCC 8492]
mgsdkihhhhhhMMKLHLKYLWIVLVACTLTACMNGGGDLAGKWQLRQYQYADGTSEKVD
SVFYNFQKGSFSAICLLKDGGLTTFFGNYSLKGAEISIILLPESVNDKNYDTYFGWPEGK
CTFKVEDLSYSSLRLEYEGTKSIFRKF

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu