LOADING...
   ZP_02067971.1;ZP_02067971.1
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02067971.1 Chemical properties of protein sequence with tag

Accession: ZP_02067971.1
Description: gi|160886968|ref|ZP_02067971.1| hypothetical protein BACOVA_04982 [Bacteroides ovatus ATCC 8483]
Organism: Bacteroides ovatus
  No Tag Tag
Residues(aa) 534 546
Molecular Weight (Dalton) 59657.58 61112.13
Isoelectric Point 4.77 5.00
Extinction Coefficient 92140 92140
Gravy -.38 -0.41
Number of Met 14 15
%Met 2.62 2.75
Number of Cys 7 7
%Cys 1.31 1.28
SEQUENCE  amino acids 546 aa; containing Tag mgsdkihhhhhh
>ZP_02067971.1 gi|160886968|ref|ZP_02067971.1| hypothetical protein BACOVA_04982 [Bacteroides ovatus ATCC 8483]
mgsdkihhhhhhMKQYKLMQVALLAILLFGWAGCSQNEEEVPGNVRNGIVLNVTDTGIIS
NEPSTRTEDTGFVTTFTQGDQIGLFAVKDGAILDEINNMPFTFNGSSWSGKPILYDDRLV
GVNFYAYYPYQSEMTGKTDLIGDDFFAPLAAGWELTTEQSDQKAYAKQDLMTSNATALIG
ENGNYSLSFQLTHRMSLVVVKLPSTRYIFTDAEGVAMPEETPYVAMSVDVAFYLDNVEEG
TKISPYYDAKKDEYRLLRKPSSENQIIGHYNDKQCTLDTAEKMKEGKYKRFVVDGGYKEV
THHLQVGDYYYADGSVVSGNEAEPAKDNCIGIVCWVGNPMPSVLYKDVAGTPYTATNDAL
LRSHPNCVHGLVMSLYTETGKFSPALTQSIHDWFMTTSFTSSYVSVTGYYDANENNKNKP
LRFLGYNNSEVLDLYYDTFKTDFECFQYQDDCESSFPSPSITTGWYVPSSGELVALQDKD
NSLESKLNTKLIKVSDKTMDISATYWSSTERNNKNMYIVTYSKTAGSAGTGGVKTNTYTY
RFFLGF

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu