LOADING...
   ZP_02067350.1;SP13839C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02067350.1 Chemical properties of protein sequence with tag

Accession: ZP_02067350.1
Description: gi|160886347|ref|ZP_02067350.1| hypothetical protein BACOVA_04357 [Bacteroides ovatus ATCC 8483]
Organism: Bacteroides ovatus
  No Tag Tag
Residues(aa) 605 617
Molecular Weight (Dalton) 68695.58 70150.13
Isoelectric Point 7.62 7.68
Extinction Coefficient 129260 129260
Gravy -.48 -0.50
Number of Met 15 16
%Met 2.48 2.59
Number of Cys 4 4
%Cys 0.66 0.65
SEQUENCE  amino acids 617 aa; containing Tag mgsdkihhhhhh
>ZP_02067350.1 gi|160886347|ref|ZP_02067350.1| hypothetical protein BACOVA_04357 [Bacteroides ovatus ATCC 8483]
mgsdkihhhhhhMNKLLTSLLLSVTLMSGAQAQKKENYYVKHVEFPQSATIEQKVDMAAR
LVPTPQQYAWQQMELTAFLHFGINTFTGREWGDGKEDPALFNPSELDAEQWVRTLKEAGF
KMVLLTAKHHDGFCLWPTATTKHSVASSPWKNGQGDVVKELRAACDKYDMKFGVYLSPWD
RNAECYGDSPRYNDFFIRQLTELLTNYGEVHEVWFDGANGEGPNGKKQVYDWDAFYQTIQ
RLQPKAVMAIMGDDVRWVGNEKGVGRETEWNATVLTPGIYARSQENNKRLGVFSKAEDLG
SRKILEKATELFWYPSEVDVSIRPGWFYHAEEDGKVKSLKHLSDIYFQSVGYNSVLLLNI
PPDRRGLIHEADIKRLKEFADYRQQTFADNRVKNGRKYWSTTSGGEAVYALKSKSEINLV
MLQEDITKGQRVEAFTVEALTDNGWKEVGKGTTIGYKRMLRFPAVNANKLRVRIDECRLT
AYVSQVAAYYAEPLQEETTKEDWNNLPRSGWKQVAASPLTIDLGKTVTLSSFTYAPSKAE
VKPTMAFRYQFFVSMDGKSWKEVPASGEFSNIMHNPLPQTVAFSQKVQARFIKLEATTPD
ATVAKVNMNEIGVMVIP

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu