LOADING...
   ZP_02067074.1;SP17169A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02067074.1 Chemical properties of protein sequence with tag

Accession: ZP_02067074.1
Description: gi|160886071|ref|ZP_02067074.1| hypothetical protein BACOVA_04078 [Bacteroides ovatus ATCC 8483]
Organism: Bacteroides ovatus
  No Tag Tag
Residues(aa) 370 382
Molecular Weight (Dalton) 40250.06 41704.61
Isoelectric Point 4.67 4.96
Extinction Coefficient 31400 31400
Gravy -.08 -0.14
Number of Met 9 10
%Met 2.43 2.62
Number of Cys 2 2
%Cys 0.54 0.52
SEQUENCE  amino acids 382 aa; containing Tag mgsdkihhhhhh
>ZP_02067074.1 gi|160886071|ref|ZP_02067074.1| hypothetical protein BACOVA_04078 [Bacteroides ovatus ATCC 8483]
mgsdkihhhhhhMRKKLLHIIYLASTILLFSCSREADVAYELPAHTTRAQLSIDLVNNGD
VEQQEKINSMRFIVFGSTPGGVRLDVNEHILLSTPETATDIDAQLLEVTSSNDILVVVIA
NEPQSLTSQLDGIANLLTLQEMIYDISSILNSDGQIISATGMPMTGVIRDISIAPDETKT
VQMVIERAVARVDVFIEAIDGGAVTGYTAGSTSVTLHNFSHDSYFVMGNVGNGTRDNADS
SKNYGKVKEDVSESNLLTHSWTAATTETWAYSSAPGAENRKLLCSFYTAERLFKSDYSDR
LSISMANVLKGPSDVTGITGKVIESVTKVDGTGSPTAQPFTEIRRNNVYQVTARVGKIGI
QILTISVEDWGERQDIDLDMDL

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu