LOADING...
   ZP_02066560.1;SP8524C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02066560.1 Chemical properties of protein sequence with tag

Accession: ZP_02066560.1
Description: gi|160885557|ref|ZP_02066560.1| hypothetical protein BACOVA_03559 [Bacteroides ovatus ATCC 8483]
Organism: Bacteroides ovatus
  No Tag Tag
Residues(aa) 380 392
Molecular Weight (Dalton) 41953.11 43407.66
Isoelectric Point 4.96 5.38
Extinction Coefficient 61770 61770
Gravy -.18 -0.23
Number of Met 14 15
%Met 3.68 3.83
Number of Cys 1 1
%Cys 0.26 0.26
SEQUENCE  amino acids 392 aa; containing Tag mgsdkihhhhhh
>ZP_02066560.1 gi|160885557|ref|ZP_02066560.1| hypothetical protein BACOVA_03559 [Bacteroides ovatus ATCC 8483]
mgsdkihhhhhhMMNKHIFYYLMVGSMALLLGACNDSMNDLLEPKVYFESKEYNFSVEDE
MDVMTFDLVSRLSSATSSQVDVSYSVAEPSVVDEYNAKYGTNYEMLDVSQVKLSSTTSSI
SSGKLYADNIEVELSGLEALKAGNSYVLPMRVHSSSVSTLSGTNIAYFFFSKPLKITKAG
NFSNHYISVKFPVGTFFSSFTYEALINVDYFLDNNTIMGTEGVMILRIGDAGGGITPKDY
LEVAGGQNYRVTKPLLTNRWYHVALTYDQPTGKTGIYVNGEKWAGSDWGIDGFDPNSDMG
FYIGRIYGFKWGERPFHGKMSEVRVWSVARTENQLKQNMLGVDPASEGLALYYKLDGSET
QEGGVIKDATGRINGTTNGITIKTLDAPIAIN

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu