LOADING...
   ZP_02063319.1;SP13221C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02063319.1 Chemical properties of protein sequence with tag

Accession: ZP_02063319.1
Description: gi|160882316|ref|ZP_02063319.1| hypothetical protein BACOVA_00264 [Bacteroides ovatus ATCC 8483]
Organism: Bacteroides ovatus
  No Tag Tag
Residues(aa) 465 477
Molecular Weight (Dalton) 52483.33 53937.88
Isoelectric Point 5.79 6.06
Extinction Coefficient 85720 85720
Gravy -.41 -0.45
Number of Met 9 10
%Met 1.94 2.10
Number of Cys 13 13
%Cys 2.80 2.73
SEQUENCE  amino acids 477 aa; containing Tag mgsdkihhhhhh
>ZP_02063319.1 gi|160882316|ref|ZP_02063319.1| hypothetical protein BACOVA_00264 [Bacteroides ovatus ATCC 8483]
mgsdkihhhhhhMIQVTRRHVFSKALLQKTLFVAGLVLFSSCYKGSTLDVNQDSGTPFNP
KEEIVVEKFLPTEGRKGTRVVVYGRNFGNDVSKVKVTIGGYPAKVINVKGESLLCICPSK
AYEGDVKVSVVGDDEAELKSGVCEAKFDYQYNYVVTTFLGKLYENNTKWDVLAGPFDDCG
AFDNIWRMMFDPNSNYDDLYWVGQRDAFRHVDFVNQYVDIKTTNIGQCADVNFTLNGDMV
VVDDQSSDTNTGIYLFTRASGFTERLSLCNARGAKTCAVHPQNGKIYYTRYHHAMISSYD
PATGTLTEEEVMMDTKGSNFHIVWHPTGDWAYIIYNGKHCIYRVDYNRETGKLAVPYIVC
GQHSSPGWVDGMGTGARLWGPNQGIFVKNEAYAGEEDEYDFYFCDRDSHTVRVLTPEGRV
TTYAGRGNSREWGYVDGELRSQALFNHPTSIAYDMKRKCFYIGDCDNHRVRKIAPEE

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu