LOADING...
   ZP_02043836.1;SP17439A
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02043836.1 Chemical properties of protein sequence with tag

Accession: ZP_02043836.1
Description: gi|154508194|ref|ZP_02043836.1| hypothetical protein ACTODO_00688 [Actinomyces odontolyticus ATCC 17982]
Organism: ACTINOMYCES ODONTOLYTICUS ATCC 17982
  No Tag Tag
Residues(aa) 352 364
Molecular Weight (Dalton) 36499.67 37954.22
Isoelectric Point 4.49 4.79
Extinction Coefficient 22920 22920
Gravy -.06 -0.11
Number of Met 7 8
%Met 1.99 2.20
Number of Cys 3 3
%Cys 0.85 0.82
SEQUENCE  amino acids 364 aa; containing Tag mgsdkihhhhhh
>ZP_02043836.1 gi|154508194|ref|ZP_02043836.1| hypothetical protein ACTODO_00688 [Actinomyces odontolyticus ATCC 17982]
mgsdkihhhhhhMKKGVAALGALSLTSALLMSACGGGTSTQGSESSSGGDASGSYDVSSQ
SITFIPKQLNNPFSDVMLGGGKNAAGEIGFAEVNVVGPLEASSSSQVSFINSEVQAGTNV
LVIAANDPDAVCPALQDARKAGTKVVTFDSDSAADCRDLFINQVESKQVAITMLDMVSDQ
IGGSGKVAILSATANAANQNAWIKFMEDEIASNDKYKGIEIVAKVYGDDDDTKSFQEAQG
LLQAHPDLNAIVSPTTVGIAATARYLSTSDYKGKVFLTGLGLPNEMRSFVKDGTVKEFAL
WDPAQLGYVAAYAGAALDSGAIKGEVGEKFTAGNLGERTIGENKTVVVGDPVRFNADNID
KYDF

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu