LOADING...
   ZP_02040096.1;SP17422C
Protein Sequence Comparative Analysis   (PSCA)
 
  Back to Target List
 
ZP_02040096.1 Chemical properties of protein sequence with tag

Accession: ZP_02040096.1
Description: gi|154503036|ref|ZP_02040096.1| hypothetical protein RUMGNA_00858 [Ruminococcus gnavus ATCC 29149]
Organism: Ruminococcus gnavus ATCC 29149
  No Tag Tag
Residues(aa) 278 290
Molecular Weight (Dalton) 30287.2 31741.75
Isoelectric Point 4.53 4.76
Extinction Coefficient 20860 20860
Gravy -.31 -0.37
Number of Met 1 2
%Met 0.36 0.69
Number of Cys 1 1
%Cys 0.36 0.34
SEQUENCE  amino acids 290 aa; containing Tag mgsdkihhhhhh
>ZP_02040096.1 gi|154503036|ref|ZP_02040096.1| hypothetical protein RUMGNA_00858 [Ruminococcus gnavus ATCC 29149]
mgsdkihhhhhhMKKVTAIILTGILTLGVLTGCQSNSKAEEKGSSEDAKTIKVAASATPH
AEILEQAKSILKKEGYQLEVTVFDDYVQPNEVVESGEFDANYFQHVPYLESFNEEKGTHL
VDAGDIHYEPFGIYPGTKKSLDEISEGDKIAVPNDTTNEARALLLLQDNGIITLKDGAGL
NATVNDIEENPYNVEIVELEAAQVARVTGETAYVVLNGNYALEAGYSVAKDALAYEKSDS
EAAKTYVNIIAVKEGNEKEEKIQALVKALKSDEIKEYIEKTYDGAVIPFE

Notes: Most of the JCSG constructs have a 6thio6his tag immediately before the N-terminal tag. This means that every protein expressed and purified has the tag amino acids (MGSDKIHHHHHH) in front of the N-terminus.
Contact Webmaster JCSG Menu